BCRF1 Protein, EBV (His, Myc)
IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. BCRF1, EBV (His, Myc) is the recombinant virus-derived BCRF1 protein, expressed by E. coli, with C-His labeled tag.
- Species: Virus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-10 Protein critically masks infected cells for immune evasion by down-regulating the host TAP1 gene, hindering peptide transport into the endoplasmic reticulum and loading onto MHC class I molecules. IL-10 also inhibits IFN-gamma synthesis and exists as a homodimer. BCRF1, EBV (His, Myc) is the recombinant virus-derived BCRF1 protein, expressed by E. coli, with C-His labeled tag.
Background
The IL-10 protein plays a critical role in immune recognition by cytotoxic T-lymphocytes, as it is involved in masking infected cells. It accomplishes this by down-regulating the expression of the host TAP1 gene, which hampers the transport of peptides into the endoplasmic reticulum and their subsequent loading onto MHC class I molecules. Additionally, IL-10 inhibits the synthesis of IFN-gamma. It exists as a homodimer.
Technical Parameters
-
Species Virus
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P03180 (T24-R170)
-
Gene ID3783689
-
Protein Length
Full Length of Mature Protein
-
Synonyms
BCRF1; Viral interleukin-10 homolog; vIL-10; 20 kDa protein; Protein BCRF1
-
AA Sequence
TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR
-
Predicted Molecular Mass
24.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
