IL-12 alpha Protein, Human (HEK293, hFc)
IL-35 protein plays a key role in immune regulation, forming IL-12 cytokine with IL12B or IL-35 cytokine with EBI3/IL27B. IL-12 modulates T cell and natural killer cell responses and induces interferon gamma production. IL-12 alpha Protein, Human (HEK293, hFc) is the recombinant human-derived IL-12 alpha protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-35 protein plays a key role in immune regulation, forming IL-12 cytokine with IL12B or IL-35 cytokine with EBI3/IL27B. IL-12 modulates T cell and natural killer cell responses and induces interferon gamma production. IL-12 alpha Protein, Human (HEK293, hFc) is the recombinant human-derived IL-12 alpha protein, expressed by HEK293, with C-hFc labeled tag.
Background
IL-35 Protein plays a pivotal role in immune regulation, exhibiting versatility in its functions. It heterodimerizes with IL12B to form the IL-12 cytokine or with EBI3/IL27B to create the IL-35 cytokine. IL-12, primarily produced by professional antigen-presenting cells such as B-cells, dendritic cells, macrophages, and granulocytes, serves as a crucial link between innate resistance and adaptive immunity, regulating T-cell and natural killer-cell responses while inducing interferon-gamma production and favoring the differentiation of T-helper 1 cells. Mechanistically, IL-12 exerts its effects through a receptor composed of IL12R1 and IL12R2 subunits, leading to tyrosine phosphorylation of cellular substrates and subsequent regulation of cytokine/growth factor responsive genes by recruited phosphorylated STAT4. In the context of IL-35, IL-35 contributes significantly to maintaining immune homeostasis in the liver microenvironment and functions as an immune-suppressive cytokine. Notably, IL-35 mediates its effects through unconventional receptors composed of IL12RB2 and gp130/IL6ST heterodimers or homodimers, requiring the transcription factors STAT1 and STAT4 for signaling. Additionally, IL-35 interacts with NBR1, promoting IL-12 secretion. The IL-35 heterodimer with EBI3/IL27B, known as interleukin IL-35, is not disulfide-linked, distinguishing it from the disulfide-linked IL-12 heterodimer with IL12B.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P29459 (R23-S219)
-
Gene ID3592
-
Molecular Construction
-
N-term
-
IL-12α (R23-S219)
Accession # P29459 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL12A; Cytotoxic Lymphocyte Maturation Factor 1, P35; Prev. NKSF1; NK Cell Stimulatory Factor Chain 1; IL-12A; Interleukin-12 Alpha Chain; Interleukin-12 Subunit Alpha; Interleukin 12, P35; CLMF; IL-12, Subunit P35; NFSK; IL35 Subunit; P35; CLMF P35; Inte
-
AA Sequence
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
-
Predicted Molecular Mass
49.2 kDa
-
Molecular Weight
Approximately 57-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)