IL-18 Protein, Dog (His)
IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.
- Species: Dog
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-18 protein is a pro-inflammatory cytokine that is critical for epithelial barrier repair and immune regulation, especially in Th1 and NK cell responses. IL18R1 and IL18RAP combine to form a signaling ternary complex that activates NF-kappa-B and induces inflammatory mediators. IL-18 Protein, Dog (His) is the recombinant dog-derived IL-18 protein, expressed by E. coli , with N-His labeled tag.
Background
IL-18 Protein is a pro-inflammatory cytokine that plays a crucial role in epithelial barrier repair and modulating immune responses, particularly in polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses. It forms a signaling ternary complex upon binding to IL18R1 and IL18RAP, activating NF-kappa-B and triggering the synthesis of inflammatory mediators. IL-18 also synergizes with IL-12/interleukin-12 to induce the synthesis of IFNG from Th1 cells and NK cells. In addition, IL-18 is involved in transducing inflammation downstream of pyroptosis, where its mature form is selectively released into the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It forms a ternary complex with the ligand-binding receptor subunit IL18R1 and the signaling receptor subunit IL18RAP at the plasma membrane, and its interaction with the cargo receptor TMED10 mediates translocation from the cytoplasm into the ERGIC (endoplasmic reticulum-Golgi intermediate compartment) for secretion.
Technical Parameters
-
Species Dog
-
Source E. coli
-
Tag N-His
-
Accession
Q9XSR0 (Y37-S193)
-
Molecular Construction
-
N-term
-
His
-
IL-18 (Y37-S193)
Accession # Q9XSR0 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL18; Interleukin 18 (Interferon-Gamma-Inducing Factor); Interleukin 18; IFN-Gamma-Inducing Factor; IL-18; Interleukin-1 Gamma; IL1F4; Iboctadekin; IGIF; IL-1 Gamma; Interleukin-18; Interferon-Gamma-Inducing Factor; IL-1g; Interferon Gamma-Inducing Factor
-
AA Sequence
YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS
-
Predicted Molecular Mass
22 kDa
-
Molecular Weight
Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
