IL-21 Protein, Rat (sf9, His)
IL-21 protein is an immunomodulatory cytokine that plays a key role in the transition from innate immunity to adaptive immunity. It induces IgG(1) and IgG(3) in B cells, which are critical for T follicular helper (Tfh) cell development, germinal center formation, and robust antibody responses, especially in acute viral infections. IL-21 Protein, Rat (sf9, His) is the recombinant rat-derived IL-21 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-21 protein is an immunomodulatory cytokine that plays a key role in the transition from innate immunity to adaptive immunity. It induces IgG(1) and IgG(3) in B cells, which are critical for T follicular helper (Tfh) cell development, germinal center formation, and robust antibody responses, especially in acute viral infections. IL-21 Protein, Rat (sf9, His) is the recombinant rat-derived IL-21 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
IL-21 Protein is an immunoregulatory cytokine that plays a crucial role in the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) in B-cells and is involved in the development and maintenance of T follicular helper (Tfh) cells and the formation of germinal centers. Working in conjunction with IL6, IL-21 Protein is essential for the early generation of Tfh cells and contributes to a robust antibody response during acute viral infections. It also synergizes with IL15 to promote the proliferation and maturation of natural killer (NK) cells and can regulate the proliferation of mature B- and T-cells upon activation. IL-21 Protein, in collaboration with IL15 and IL18, stimulates the production of interferon gamma in T-cells and NK cells. Furthermore, it can inhibit the activation and maturation of dendritic cells during T-cell mediated immune responses.
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
A3QPB9 (H18-S146)
-
Molecular Construction
-
N-term
-
IL-21 (H18-S146)
Accession # A3QPB9 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL21; Interleukin-21; Interleukin 21; Interleukin; IL-21; CVID11; Za11
-
AA Sequence
HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
-
Predicted Molecular Mass
16.6 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
