1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-21
  5. IL-21 Protein, Rat (sf9, His)

IL-21 protein is an immunomodulatory cytokine that plays a key role in the transition from innate immunity to adaptive immunity. It induces IgG(1) and IgG(3) in B cells, which are critical for T follicular helper (Tfh) cell development, germinal center formation, and robust antibody responses, especially in acute viral infections. IL-21 Protein, Rat (sf9, His) is the recombinant rat-derived IL-21 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-21 protein is an immunomodulatory cytokine that plays a key role in the transition from innate immunity to adaptive immunity. It induces IgG(1) and IgG(3) in B cells, which are critical for T follicular helper (Tfh) cell development, germinal center formation, and robust antibody responses, especially in acute viral infections. IL-21 Protein, Rat (sf9, His) is the recombinant rat-derived IL-21 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

IL-21 Protein is an immunoregulatory cytokine that plays a crucial role in the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) in B-cells and is involved in the development and maintenance of T follicular helper (Tfh) cells and the formation of germinal centers. Working in conjunction with IL6, IL-21 Protein is essential for the early generation of Tfh cells and contributes to a robust antibody response during acute viral infections. It also synergizes with IL15 to promote the proliferation and maturation of natural killer (NK) cells and can regulate the proliferation of mature B- and T-cells upon activation. IL-21 Protein, in collaboration with IL15 and IL18, stimulates the production of interferon gamma in T-cells and NK cells. Furthermore, it can inhibit the activation and maturation of dendritic cells during T-cell mediated immune responses.

Species

Rat

Source

Sf9 insect cells

Tag

C-His

Accession

A3QPB9 (H18-S146)

Gene ID
Molecular Construction
N-term
IL-21 (H18-S146)
Accession # A3QPB9
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-21; Il21; Za11
AA Sequence

HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS

Predicted Molecular Mass
16.6 kDa
Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

IL-21 Protein, Rat (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-21 Protein, Rat (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-21 Protein, Rat (sf9, His)
Cat. No.:
HY-P74817
Quantity:
MCE Japan Authorized Agent: