IL-22 Protein, Rabbit (HEK293, His)
Based on 1 Customer Validation
IL-22 Protein, Rabbit (HEK293, His) is the recombinant rabbit-derived IL-22 protein, expressed by HEK293, with C-8*His tag.
- Species: Rabbit
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-22 Protein, Rabbit (HEK293, His) is the recombinant rabbit-derived IL-22 protein, expressed by HEK293, with C-8*His tag.
Background
IL-22 Protein belongs to the IL-10 family and is recognized for its significant divergence from other family members. This protein functions as a vital cytokine involved in numerous immune responses and inflammatory processes. IL-22 plays a crucial role in promoting the activation and recruitment of immune cells, including T-helper 2 (Th2) cells, mast cells, and eosinophils, to sites of inflammation. It is primarily secreted by epithelial and endothelial cells and exerts its effects through the IL-22 receptor. Upon binding, IL-22 stimulates the production of various pro-inflammatory cytokines and chemokines. Notably, IL-22 has been implicated in a wide range of diseases, such as asthma, allergic diseases, and autoimmune disorders, underscoring its significance as a potential therapeutic target for modulating immune responses.
Verified Bioactivity
Immobilized rabbit IL-22, His Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Human IL-22R alpha 1, hFc Tag with the EC50 of 10.3-18.1ng/ml determined by ELISA.
Technical Parameters
-
Species Rabbit
-
Source HEK293
-
Tag C-8*His
-
Accession
G1SFV3 (L34-S187)
-
Gene ID100348980
-
Molecular Construction
-
N-term
-
IL-22 (L34-S187)
Accession # G1SFV3 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL22; TIFa; Interleukin 22; IL-10-Related T-Cell-Derived Inducible Factor; IL-TIF; Cytokine Zcyto18; ILTIF; Interleukin-22; IL-22; MGC79382; TIFIL-23; MGC79384; Zcyto18; IL-10-Related T-Cell-Derived-Inducible Factor; IL-D110; Interferon 2B1; IL-21; ZCYTO1
-
AA Sequence
LPISSHCRLDESNFTSYITNLTFMLAKEANSADNNTDVRLIGNELFHGVNEKDHCYLLKHVLNFTLEEVLFPESDRFQPYMQQVLSFLAKLSNNLSQCHIEGDDQHIQRNVQQLKDTVKQLGESGEIKAIGELDLLFMALRTACVSPEQSWKMS
-
Predicted Molecular Mass
19.2 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS pH 7.4. Normally 8% trehalose is added as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
