IL-27 Protein, Mouse (228a.a, HEK293, His, solution)

IL-27 is mainly produced by cells of myeloid origin such as monocytes, macrophages, dendritic cells, and microglial cells, in response to stimuli acting through Toll-like receptors or TNF-R-family members^[3].
The amino acid sequence of human IL-27 protein has low homology for mouse IL-27 protein.
IL-27 acts through a heterodimer receptor consisting of IL-27Rα (WSX1) and gp130 chains, activates the JAK/STAT signaling pathway, which mainly involves STAT1 and STAT3 phosphorylation. STAT3 activation by IL-27 induces the expression of SOCS3, which inhibits further IL-27 signaling in a negative feedback loop, through inhibition of JAK activity^[3].
IL-27 plays multiple roles in proinflammatory and anti-inflammatory immune responses. IL-27 enhances NF-κB/AP-1 activity and increases IL-12p40, TNF-α, and IL-6 production, increases TLR4 and TLR5 expression^[5]. IL-27 exerts inhibitory effects upon hPMSC adherence and proliferation, and promotes migration of hPMSCs. Besides, IL-27 can upregulate PDL1 expression and enhance the regulatory effects of hPMSCs on Th1 and Th2 cell differentiations and IL-10 secretion from CD4+T cells^[6]. IL-27 induces the proliferation and differentiation in hematopoietic stem cells^[7]. IL-27 increases IL-10 levels and the expression of p-STAT1, p-STAT3^[8]. IL-27 promotes the development and differentiation of CD4+IL-10+ T cells^[9].

1.Measured by its binding ability in a functional ELISA. Immobilized mouse IL27-His at 10 μg/mL (100 μl/well) can bind human IL27RA-Fc and the EC₅₀ is 0.26-0.62 μg/mL.
2.Measured in antiviral assay using HepG2 cells infected with vesicular stomatitisvirus (VSV) and the ED₅₀ is 2-10ng/mL.

Mouse

HEK293

C-10*His

O35228 (Y19-P228) &GSGSGGSGGSGSGKL& Q8K3I6 (F29-S234)

50498&246779

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Approximately 60 kDa

Greater than 90% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.