Copy Link Print Information

IL-27 Protein, Mouse (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (228a.a, HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293, with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for IL-27 Protein, Mouse (HEK293, His, solution)
  • IL-27 Protein, Mouse (HEK293, His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling. IL-27 Protein, Mouse (228a.a, HEK293, His, solution) is the recombinant mouse-derived IL-27, expressed by HEK293, with C-10*His labeled tag.

Background

IL-12, in association with IL23A, forms the IL-23 interleukin, a heterodimeric cytokine that plays essential roles in innate and adaptive immunity. This cytokine is implicated in the acute response to infection in peripheral tissues and binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activating the Jak-Stat signaling cascade. IL-23 stimulates memory T-cells rather than naive T-cells and promotes the production of pro-inflammatory cytokines. It has been identified as a contributor to autoimmune inflammation, potentially responsible for autoimmune inflammatory diseases and implicated in tumorigenesis. Additionally, IL-12 functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells, and stimulating interferon-gamma production by resting PBMC.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse IL27 / Interleukin-27 Protein (His Tag) at 10 μg/mL (100 μl/well) can bind Recombinant Human IL27Ra / TCCR / WSX1 Protein (Fc Tag) and the EC50 is ≤0.7 μg/mL.
2.Measured in antiviral assay using HepG2 cells infected with vesicular stomatitisvirus (VSV) and the ED50 is ≤10ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession

    O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234)

  • Gene ID
    50498&246779
  • Synonyms

    EBI3; IL-27 Subunit Beta; Epstein-Barr Virus Induced 3; IL27 Subunit; IL27B; IL35 Subunit; IL35B; IL-27B; Epstein-Barr Virus-Induced Gene 3 Protein; Epstein-Barr Virus Induced Gene 3; Interleukin-27 Subunit Beta; Cytokine Receptor; EBV-Induced Gene 3 Protein; IL27; Interleukin-27 Subunit Alpha; Prev. IL30; Interleukin-30; IL27A; MGC71873; P28; IL-27-A; IL27p28; IL27-A; IL-27A; IL-27 P28 Subunit; IL-27; Interleukin 30; Interleukin 27; IL-27 Subunit Alpha

  • AA Sequence

    YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

  • Predicted Molecular Mass

    49.5 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
2.Supplied as a 0.22 μm filtered solution of 20 mM MOPS, 150 mM NaCl, 0.05% CHAPS, pH 7.2.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • IL-27 Protein, Mouse (HEK293, His, solution) Product Image
    1/16
  • Experimental Validation Results for IL-27 Protein, Mouse (HEK293, His, solution)
  • IL-27 Protein, Mouse (HEK293, His, solution) Product Image