IL-2R beta/CD122 Protein, Mouse (HEK293, hFc)
IL-2R beta/CD122 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IL-2R beta/CD122 protein, expressed by HEK293, with C-hFc tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-2R beta/CD122 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived IL-2R beta/CD122 protein, expressed by HEK293, with C-hFc tag.
Background
IL-2R beta serves as a receptor subunit for interleukin-2, mediating receptor endocytosis and transducing IL2's mitogenic signals. It likely collaborates with IL15RA to facilitate IL15-induced neutrophil phagocytosis (By similarity).
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P16297 (A27-E240)
-
Gene ID16185
-
Molecular Construction
-
N-term
-
IL-2Rβ (A27-E240)
Accession # P16297 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IL2RB; Interleukin 2 Receptor, Beta; Prev. IL15RB; IL-2R Subunit Beta; High Affinity IL-2 Receptor Subunit Beta; CD122 Antigen; Interleukin-2 Receptor Subunit Beta; IL-2RB; P70-75; P75; CD122; High Affinity IL-2 Receptor Beta Subunit; Interleukin-15 Recep
-
AA Sequence
AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
-
Predicted Molecular Mass
51.5 kDa
-
Molecular Weight
Approximately 65-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
