1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. Multi-CSF/IL-3
  5. IL-3 Protein, Rhesus macaque (His)

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
2 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-3, a hematopoietic cytokine, exerts regulatory control over hematopoiesis by influencing the production, differentiation, and function of distinct white blood cell populations, including granulocytes, monocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils, and megakaryocytes. Acting as a colony-stimulating factor, IL-3 plays a crucial role in promoting the development and maturation of these various cell types within the blood, contributing to the maintenance of a functional and balanced immune system.

Actividad biológica

Measured in a cell proliferation assay using using TF1 human human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.

  • Measured in a cell proliferation assay using TF1 human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.
Species

Rhesus Macaque

Source

E. coli

Tag

N-6*His

Accession

P25140 (A20-Q143)

Gene ID
Molecular Construction
N-term
6*His
IL-3 (A20-Q143)
Accession # P25140
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL3; Interleukin-3; IL-3; Hematopoietic growth factor; Mast cell growth factor; MCGF; Multipotential colony-stimulating factor; P-cell-stimulating factor
AA Sequence

APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

Predicted Molecular Mass
14 kDa
Peso molecular

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

IL-3 Protein, Rhesus macaque (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-3 Protein, Rhesus macaque (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-3 Protein, Rhesus macaque (His)
Cat. No.:
HY-P71858A
Cantidad:
MCE Japan Authorized Agent: