Copy Link Print Information

IL-3 Protein, Rhesus macaque (His)

Customer Review

Based on 1 Customer Validation

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-3 Protein, Rhesus macaque (His)
  • Experimental Validation Results for IL-3 Protein, Rhesus macaque (His)
  • IL-3 Protein, Rhesus macaque (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-3, a hematopoietic cytokine, exerts regulatory control over hematopoiesis by influencing the production, differentiation, and function of distinct white blood cell populations, including granulocytes, monocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils, and megakaryocytes. Acting as a colony-stimulating factor, IL-3 plays a crucial role in promoting the development and maturation of these various cell types within the blood, contributing to the maintenance of a functional and balanced immune system.

Verified Bioactivity

Measured in a cell proliferation assay using using TF1 human human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF1 human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source E. coli
  • Tag N-6*His
  • Accession

    P25140 (A20-Q143)

  • Gene ID
    706946  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IL-3 (A20-Q143)
      Accession # P25140
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I

  • AA Sequence

    APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ

  • Predicted Molecular Mass

    14 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF1 human erythroleukemic cells.The ED50 for this effect is 0.8725 ng/mL, corresponding to a specific activity is 1.146×106 units/mg.

  • IL-3 Protein, Rhesus macaque (His) Product Image
    1/16
  • Experimental Validation Results for IL-3 Protein, Rhesus macaque (His)
  • Experimental Validation Results for IL-3 Protein, Rhesus macaque (His)
  • IL-3 Protein, Rhesus macaque (His) Product Image