IL-33 Protein, Mouse (Biotinylated, HEK293, His-Avi)

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. IL-33, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-33 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-33 protein activates NF-kappa-B and MAPK signaling, inducing Th2 cell maturation and cytokine secretion. It activates mast cells, basophils, eosinophils, and natural killer cells and enhances macrophage polarization. IL-33, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-33 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.

Background

The IL-33 Protein, a cytokine, binds to and signals through the IL1RL1/ST2 receptor, activating NF-kappa-B and MAPK signaling pathways in target cells. It is implicated in the maturation of Th2 cells, inducing the secretion of T-helper type 2-associated cytokines. Furthermore, IL-33 is involved in the activation of mast cells, basophils, eosinophils, and natural killer cells, acting as an enhancer of the polarization of alternatively activated macrophages. It serves as a chemoattractant for Th2 cells and may function as an 'alarmin,' amplifying immune responses during tissue injury. Notably, it induces rapid UCP2-dependent mitochondrial rewiring, attenuating the generation of reactive oxygen species and preserving the integrity of the Krebs cycle required for the persistent production of itaconate, leading to GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages. In quiescent endothelia, the uncleaved form of IL-33 is constitutively and abundantly expressed, acting as a chromatin-associated nuclear factor with transcriptional repressor properties, potentially sequestering nuclear NF-kappaB/RELA and lowering the expression of its targets. This form is rapidly lost upon angiogenic or pro-inflammatory activation.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-Avi;N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Avi-His
    • IL-33 (S109-I266)
      Accession # Q8BVZ5
    • C-term
  • Protein Length

    Full Length of Interleukin-33 (109-266) Chain

  • Conjugation

    Biotin

  • Synonyms

    IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33

  • AA Sequence

    SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI

  • Predicted Molecular Mass

    21.3 kDa

  • Molecular Weight

    Approximately 22-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00