1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-33
  5. IL-33 Protein, Rhesus macaque (His)

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-33 belongs to the IL-1 family and is characterized by its high divergence.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.
Species

Rhesus Macaque

Source

E. coli

Tag

N-6*His

Accession

F7DLG4 (S112-I270)

Gene ID
Molecular Construction
N-term
6*His
IL-33 (S112-I270)
Accession # F7DLG4
C-term
Protein Length

Partial

Synonyms
Interleukin-33; IL-33; IL-1F11; NF-HEV; IL33; C9orf26
AA Sequence

SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRPFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

Predicted Molecular Mass
20.3 kDa
Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-33 Protein, Rhesus macaque (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-33 Protein, Rhesus macaque (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-33 Protein, Rhesus macaque (His)
Cat. No.:
HY-P72548
Quantity:
MCE Japan Authorized Agent: