Copy Link Print Information

IL-33 Protein, Rhesus macaque (His)

Customer Review

Based on 1 Customer Validation

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-33 Protein, Rhesus macaque (His)
  • Experimental Validation Results for IL-33 Protein, Rhesus macaque (His)
  • IL-33 Protein, Rhesus macaque (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-33 is a member of the IL-1 family, known for its significant divergence. IL-33 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Background

IL-33 belongs to the IL-1 family and is characterized by its high divergence.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.

Technical Parameters

  • Species Rhesus Macaque
  • Source E. coli
  • Tag N-6*His
  • Accession

    F7DLG4 (S112-I270)

  • Gene ID
    717301  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IL-33 (S112-I270)
      Accession # F7DLG4
    • C-term
  • Protein Length

    Full Length of Interleukin 33 C-terminal Domain

  • Synonyms

    IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33

  • AA Sequence

    SITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRPFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI

  • Predicted Molecular Mass

    20.3 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque IL-33 at 5 μg/mL (100 μL/well) can bind biotinylated Human IL-1RL1. The ED50 for this effect is 148.3 ng/mL.

  • IL-33 Protein, Rhesus macaque (His) Product Image
    1/16
  • Experimental Validation Results for IL-33 Protein, Rhesus macaque (His)
  • Experimental Validation Results for IL-33 Protein, Rhesus macaque (His)
  • IL-33 Protein, Rhesus macaque (His) Product Image