IL-5 Protein, Rabbit (HEK293, His)

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

IL5 Protein is a homodimeric cytokine primarily expressed by T-lymphocytes and NK cells. It plays a crucial role in the survival, differentiation, and chemotaxis of eosinophils. Additionally, IL5 Protein acts on both activated and resting B-cells, stimulating immunoglobulin production, growth, and differentiation. Its biological effects are mediated through a receptor composed of IL5RA subunit and the cytokine receptor common subunit beta/CSF2RB, triggering the activation of various kinases such as LYN, SYK, and JAK2. This activation, in turn, propagates signals through the RAS-MAPK and JAK-STAT5 pathways, contributing to IL5 Protein's functions. IL5 Protein exists as a homodimer linked by disulfide bonds.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.276 ng/mL, corresponding to a specific activity is 3.6×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is 0.276 ng/mL, corresponding to a specific activity is 3.6×10⁶ units/mg.

Rabbit

HEK293

N-6*His

G1SL79 (M20-S134)

100358075  [NCBI]

Full Length of Mature Protein

MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

Approximately 15, 16-20 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.