Copy Link Print Information

IL-5 Protein, Rabbit (HEK293, His)

Customer Review

Based on 1 Customer Validation

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-5 Protein, Rabbit (HEK293, His)
  • Experimental Validation Results for IL-5 Protein, Rabbit (HEK293, His)
  • IL-5 Protein, Rabbit (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The IL5 protein is a cytokine that plays a key role in regulating the growth and differentiation of eosinophils, a type of white blood cell involved in allergic reactions and asthma. Dysregulation of IL5 protein is associated with a variety of allergic and inflammatory diseases. IL-5 Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived IL-5 protein, expressed by HEK293 , with N-6*His labeled tag.

Background

IL5 Protein is a homodimeric cytokine primarily expressed by T-lymphocytes and NK cells. It plays a crucial role in the survival, differentiation, and chemotaxis of eosinophils. Additionally, IL5 Protein acts on both activated and resting B-cells, stimulating immunoglobulin production, growth, and differentiation. Its biological effects are mediated through a receptor composed of IL5RA subunit and the cytokine receptor common subunit beta/CSF2RB, triggering the activation of various kinases such as LYN, SYK, and JAK2. This activation, in turn, propagates signals through the RAS-MAPK and JAK-STAT5 pathways, contributing to IL5 Protein's functions. IL5 Protein exists as a homodimer linked by disulfide bonds.

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 0.276 ng/mL, corresponding to a specific activity is 3.6×106 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.276 ng/mL, corresponding to a specific activity is 3.6×106 units/mg.

Technical Parameters

  • Species Rabbit
  • Source HEK293
  • Tag N-6*His
  • Accession

    G1SL79 (M20-S134)

  • Gene ID
    100358075  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • IL-5 (M20-S134)
      Accession # G1SL79
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL5; T-Cell Replacing Factor; Interleukin 5; EDF; Eosinophil Differentiation Factor; Colony-Stimulating Factor, Eosinophil; Interleukin-5; B-Cell Differentiation Factor I; IL-5; Interleukin 5 (Colony-Stimulating Factor, Eosinophil); TRF; B Cell Differenti

  • AA Sequence

    MATEIRMSTVVKETLTLLSTYQSLLIGNETLMIPVPVHKNHHLCIEETFRGVDTLKAQIVQGEAMDNLFQNLYLIKKYIDLQKKKCGEERRGVKHFLDYLQEFLGVINTEWTMES

  • Predicted Molecular Mass

    15.2 kDa

  • Molecular Weight

    Approximately 15 kDa & 16-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.276 ng/mL, corresponding to a specific activity is 3.6×106 units/mg.

  • IL-5 Protein, Rabbit (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IL-5 Protein, Rabbit (HEK293, His)
  • Experimental Validation Results for IL-5 Protein, Rabbit (HEK293, His)
  • IL-5 Protein, Rabbit (HEK293, His) Product Image