IL-6 Protein, Canine

Customer Review

Based on 1 Customer Validation

IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.

Background

IL-6 protein, a versatile cytokine, exerts a wide range of biological functions in immunity, tissue regeneration, and metabolism. Upon binding to its receptor IL6R, the complex associates with the signaling subunit IL6ST/gp130, initiating the intracellular IL-6 signaling pathway. The interaction between membrane-bound IL6R and IL6ST triggers 'classic signaling,' while the binding of IL-6 and soluble IL6R to IL6ST stimulates 'trans-signaling.' Additionally, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 is a potent inducer of the acute phase response, contributing to host defense during infection and tissue injury; however, excessive IL-6 synthesis is implicated in disease pathology. In the innate immune response, myeloid cells such as macrophages and dendritic cells synthesize IL-6 upon recognizing pathogens through toll-like receptors (TLRs) at the infection or injury site. Furthermore, IL-6 is crucial in the adaptive immune response, essential for B cell differentiation into immunoglobulin-secreting cells and playing a major role in the differentiation of CD4(+) T cell subsets, including the development of T follicular helper (Tfh) cells needed for germinal-center formation and driving naive CD4(+) T cells to the Th17 lineage. IL-6 also proves necessary for myeloma cell proliferation and the survival of plasmablast cells.

Verified Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 15.5 ng /mL, corresponding to a specific activity is 6.45×104 units/mg.

Technical Parameters

  • Species Canine
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-6 (T23-M207)
      Accession # P41323
    • C-term
  • Protein Length

    Full Length of Interleukin-6 Chain

  • Synonyms

    IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ

  • AA Sequence

    TPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIM

  • Predicted Molecular Mass

    20.7 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00