IL-6 Protein, Canine
Based on 1 Customer Validation
IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.
Background
IL-6 protein, a versatile cytokine, exerts a wide range of biological functions in immunity, tissue regeneration, and metabolism. Upon binding to its receptor IL6R, the complex associates with the signaling subunit IL6ST/gp130, initiating the intracellular IL-6 signaling pathway. The interaction between membrane-bound IL6R and IL6ST triggers 'classic signaling,' while the binding of IL-6 and soluble IL6R to IL6ST stimulates 'trans-signaling.' Additionally, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 is a potent inducer of the acute phase response, contributing to host defense during infection and tissue injury; however, excessive IL-6 synthesis is implicated in disease pathology. In the innate immune response, myeloid cells such as macrophages and dendritic cells synthesize IL-6 upon recognizing pathogens through toll-like receptors (TLRs) at the infection or injury site. Furthermore, IL-6 is crucial in the adaptive immune response, essential for B cell differentiation into immunoglobulin-secreting cells and playing a major role in the differentiation of CD4(+) T cell subsets, including the development of T follicular helper (Tfh) cells needed for germinal-center formation and driving naive CD4(+) T cells to the Th17 lineage. IL-6 also proves necessary for myeloma cell proliferation and the survival of plasmablast cells.
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 15.5 ng /mL, corresponding to a specific activity is 6.45×104 units/mg.
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag Tag Free
-
Accession
P41323 (T23-M207)
-
Molecular Construction
-
N-term
-
IL-6 (T23-M207)
Accession # P41323 -
C-term
-
-
Protein Length
Full Length of Interleukin-6 Chain
-
Synonyms
IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ
-
AA Sequence
TPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIM
-
Predicted Molecular Mass
20.7 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)