IL-6 Protein, Canine

IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.

IL-6 protein, a versatile cytokine, exerts a wide range of biological functions in immunity, tissue regeneration, and metabolism. Upon binding to its receptor IL6R, the complex associates with the signaling subunit IL6ST/gp130, initiating the intracellular IL-6 signaling pathway. The interaction between membrane-bound IL6R and IL6ST triggers 'classic signaling,' while the binding of IL-6 and soluble IL6R to IL6ST stimulates 'trans-signaling.' Additionally, 'cluster signaling' occurs when membrane-bound IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 is a potent inducer of the acute phase response, contributing to host defense during infection and tissue injury; however, excessive IL-6 synthesis is implicated in disease pathology. In the innate immune response, myeloid cells such as macrophages and dendritic cells synthesize IL-6 upon recognizing pathogens through toll-like receptors (TLRs) at the infection or injury site. Furthermore, IL-6 is crucial in the adaptive immune response, essential for B cell differentiation into immunoglobulin-secreting cells and playing a major role in the differentiation of CD4(+) T cell subsets, including the development of T follicular helper (Tfh) cells needed for germinal-center formation and driving naive CD4(+) T cells to the Th17 lineage. IL-6 also proves necessary for myeloma cell proliferation and the survival of plasmablast cells.

Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is 15.5 ng /mL, corresponding to a specific activity is 6.45×10⁴ units/mg.

Canine

E. coli

Tag Free

P41323 (T23-M207)

403985  [NCBI]

Partial

TPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIM

Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.