IL-4 Protein, Canine
Based on 1 Customer Validation
The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with no tag.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with no tag.
Background
IL-4 protein actively participates in multiple B-cell activation processes and various cell types, serving as a costimulator of DNA synthesis. It induces the expression of class II MHC molecules on resting B-cells, enhances the secretion and cell surface expression of IgE and IgG1, and regulates the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Furthermore, IL-4 positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED50 is typically 5-30 ng/mL.
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag Tag Free
-
Accession
O77762 (H25-H132)
-
Molecular Construction
-
N-term
-
IL-4 (H25-H132)
Accession # O77762 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1
-
AA Sequence
HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
-
Predicted Molecular Mass
13 kDa
-
Molecular Weight
Approximately 12-14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)