1. Recombinant Proteins
  2. Others
  3. GM-CSF Protein, Canine

The CSF2 protein is a cytokine that plays a critical role in the regulation of immune responses and hematopoiesis. It stimulates the production and differentiation of white blood cells, including macrophages and granulocytes. GM-CSF Protein, Canine is the recombinant canine-derived GM-CSF protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CSF2 protein is a cytokine that plays a critical role in the regulation of immune responses and hematopoiesis. It stimulates the production and differentiation of white blood cells, including macrophages and granulocytes. GM-CSF Protein, Canine is the recombinant canine-derived GM-CSF protein, expressed by E. coli , with tag free.

Background

CSF2 protein, also known as GM-CSF, plays a crucial role in stimulating the growth and differentiation of hematopoietic precursor cells from different lineages, such as granulocytes, macrophages, eosinophils, and erythrocytes. It operates as a monomer and forms a signaling complex with the GM-CSF receptor. This receptor complex consists of two alpha, two beta, and two ligand subunits arranged in a dodecamer structure, with two head-to-head hexamers.

Biological Activity

Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is <8 ng/mL.

  • Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is 7.016 ng/mL, corresponding to a specific activity is 1.42×105 units/mg.
Species

Canine

Source

E. coli

Tag

Tag Free

Accession

P48749 (A18-K144)

Gene ID
Molecular Construction
N-term
GM-CSF (A18-K144)
Accession # P48749
C-term
Protein Length

Full Length of Mature Protein

Synonyms
colony stimulating factor 2; CSF2; Granulocyte Macrophage Growth Factor
AA Sequence

APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK

Predicted Molecular Mass
14.2 kDa
Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GM-CSF Protein, Canine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GM-CSF Protein, Canine

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GM-CSF Protein, Canine
Cat. No.:
HY-P79087
Quantity:
MCE Japan Authorized Agent: