GM-CSF Protein, Canine
Based on 1 Customer Validation
The CSF2 protein is a cytokine that plays a critical role in the regulation of immune responses and hematopoiesis. It stimulates the production and differentiation of white blood cells, including macrophages and granulocytes. GM-CSF Protein, Canine is the recombinant canine-derived GM-CSF protein, expressed by E. coli , with tag free.
- Species: Canine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CSF2 protein is a cytokine that plays a critical role in the regulation of immune responses and hematopoiesis. It stimulates the production and differentiation of white blood cells, including macrophages and granulocytes. GM-CSF Protein, Canine is the recombinant canine-derived GM-CSF protein, expressed by E. coli , with tag free.
Background
CSF2 protein, also known as GM-CSF, plays a crucial role in stimulating the growth and differentiation of hematopoietic precursor cells from different lineages, such as granulocytes, macrophages, eosinophils, and erythrocytes. It operates as a monomer and forms a signaling complex with the GM-CSF receptor. This receptor complex consists of two alpha, two beta, and two ligand subunits arranged in a dodecamer structure, with two head-to-head hexamers.
Verified Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is <8 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Canine
-
Source E. coli
-
Tag Tag Free
-
Accession
P48749 (A18-K144)
-
Molecular Construction
-
N-term
-
GM-CSF (A18-K144)
Accession # P48749 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CSF2; Molgramostim; Colony Stimulating Factor 2; Molgramostin; GMCSF; CSF; Sargramostim; Granulocyte-Macrophage Colony Stimulating Factor; GM-CSF; Granulocyte Macrophage-Colony Stimulating Factor; Colony Stimulating Factor 2 (Granulocyte-Macrophage); Colo
-
AA Sequence
APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)