1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-13
  5. IL-13 Protein, Canine (HEK293, His)

IL-13 is a cytokine. IL-13 down-regulates proinflammatory cytokine synthesis by partially inhibiting NF-kappa-B. IL-13 induces vascular cell adhesion protein 1/VCAM1 to exert its biological role through its receptor, activating JAK1 and TYK2, thereby activating STAT6. IL-13 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-13 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IL-13 is a cytokine. IL-13 down-regulates proinflammatory cytokine synthesis by partially inhibiting NF-kappa-B. IL-13 induces vascular cell adhesion protein 1/VCAM1 to exert its biological role through its receptor, activating JAK1 and TYK2, thereby activating STAT6. IL-13 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-13 protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-13 is a cytokine secreted by helper T-2 (Th2) cells, CD4 cells, natural killer T cells, mast cells, basophil cells, eosinophilic cells, and trophic cells. IL-13 is a central regulator of IgE synthesis, goblet cell hyperplasia, mucous hypersecretion, airway hyperresponsiveness, fibrosis, and chitinase upregulation, and is a vector of allergic inflammation and different diseases, including asthma. IL-13 down-regulates proinflammatory cytokine synthesis by partially inhibiting NF-kappa-B, including IL1, IL6, IL10, IL12, and TNF-α. IL-13 induces vascular cell adhesion protein 1/VCAM1 to exert its biological role through its receptors, including the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, thereby activating STAT6[1][2][3][4].

Biological Activity

Immobilized Canine IL-13 His at 5 μg/mL (100 μL/well) can bind Human IL-13RA2 Fc with a linear range of ≤405 ng/mL.

  • Immobilized Canine IL-13 His at 5 μg/mL (100 μL/well) can bind Human IL-13RA2 Fc. The ED50 for this effect is 14.56 ng/mL.
Species

Canine

Source

HEK293

Tag

C-10*His

Accession

NP_001003384 (S19-R131)

Gene ID
Molecular Construction
N-term
IL-13 (S19-R131)
Accession # NP_001003384
10*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
IL13; ALRH; BHR1; MGC116786; MGC116788; MGC116789; P600; Interleukin-13
AA Sequence

SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR

분자량

Approximately 15 & 27-40 kDa kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

IL-13 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IL-13 Protein, Canine (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IL-13 Protein, Canine (HEK293, His)
Cat. No.:
HY-P78760
수량:
MCE Japan Authorized Agent: