IL-13 Protein, Canine (HEK293, His)
Based on 1 Customer Validation
IL-13 is a cytokine. IL-13 down-regulates proinflammatory cytokine synthesis by partially inhibiting NF-kappa-B. IL-13 induces vascular cell adhesion protein 1/VCAM1 to exert its biological role through its receptor, activating JAK1 and TYK2, thereby activating STAT6. IL-13 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-13 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-13 is a cytokine. IL-13 down-regulates proinflammatory cytokine synthesis by partially inhibiting NF-kappa-B. IL-13 induces vascular cell adhesion protein 1/VCAM1 to exert its biological role through its receptor, activating JAK1 and TYK2, thereby activating STAT6. IL-13 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-13 protein, expressed by HEK293 , with C-His labeled tag.
Background
IL-13 is a cytokine secreted by helper T-2 (Th2) cells, CD4 cells, natural killer T cells, mast cells, basophil cells, eosinophilic cells, and trophic cells. IL-13 is a central regulator of IgE synthesis, goblet cell hyperplasia, mucous hypersecretion, airway hyperresponsiveness, fibrosis, and chitinase upregulation, and is a vector of allergic inflammation and different diseases, including asthma. IL-13 down-regulates proinflammatory cytokine synthesis by partially inhibiting NF-kappa-B, including IL1, IL6, IL10, IL12, and TNF-α. IL-13 induces vascular cell adhesion protein 1/VCAM1 to exert its biological role through its receptors, including the IL4R chain and the IL13RA1 chain, activating JAK1 and TYK2, thereby activating STAT6[1][2][3][4].
Verified Bioactivity
1.Immobilized Canine IL-13 His at 5 μg/mL (100 μL/well) can bind Human IL-13RA2 Fc with a linear range of ≤405 ng/mL.
2.The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 3.930-20.07 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-10*His
-
Accession
NP_001003384 (S19-R131)
-
Molecular Construction
-
N-term
-
IL-13 (S19-R131)
Accession # NP_001003384 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL13; MGC116789; Interleukin 13; ALRH; IL-13; BHR1; Interleukin-13; Bronchial Hyperresponsiveness-1 (Bronchial Asthma); P600; Allergic Rhinitis; MGC116786; NC30; MGC116788
-
AA Sequence
SPSPVTPSPTLKELIEELVNITQNQASLCNGSMVWSVNLTAGMYCAALESLINVSDCSAIQRTQRMLKALCSQKPAAGQISSERSRDTKIEVIQLVKNLLTYVRGVYRHGNFR
-
Molecular Weight
Approximately 15-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
