IL-6 Protein, Pig

Customer Review

Based on 1 Customer Validation

IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". IL-6 Protein, Pig is the recombinant pig-derived IL-6 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Pig
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". IL-6 Protein, Pig is the recombinant pig-derived IL-6 protein, expressed by E. coli , with tag free.

Background

IL-6 Protein is a versatile cytokine involved in various immune, regenerative, and metabolic processes. It exerts its effects by binding to IL6R, leading to the formation of a complex with the signaling subunit IL6ST/gp130, which activates the intracellular IL6-signaling pathway. This interaction can trigger different types of signaling, including 'classic signaling' through the membrane-bound IL6R and IL6ST, 'trans-signaling' through the binding of IL6 and soluble IL6R to IL6ST, and 'cluster signaling' through IL6:IL6R complexes on transmitter cells activating IL6ST receptors on neighboring receiver cells. IL-6 is crucial for the acute phase response, playing a role in host defense during infection and tissue injury. However, excessive IL-6 production is implicated in disease pathology. It is synthesized by myeloid cells like macrophages and dendritic cells in response to pathogen recognition through toll-like receptors (TLRs). In the adaptive immune response, IL-6 is necessary for B cell differentiation into immunoglobulin-secreting cells and plays a significant role in the differentiation of CD4(+) T cell subsets. It is an essential factor for the development of T follicular helper (Tfh) cells, which are crucial for germinal-center formation, and for the induction of the Th17 lineage in naive CD4(+) T cells. Additionally, IL-6 is required for the proliferation and survival of myeloma cells and plasmablast cells.

Verified Bioactivity

1.Measured by its binding ability in a functional ELISA. Immobilized sus scrofa (pig) IL6 at 2 μg/mL (100 μl/well) can bind Human IL-6R-His , the EC50 of Human IL-6R-His is 250-750 ng/mL.
2. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 1-5 ng/mL.

Technical Parameters

  • Species Pig
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-6 (P29-M212)
      Accession # P26893
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL6; Hybridoma Growth Factor; Prev. IFNB2; IFN-Beta-2; IL-6; BSF-2; Interleukin-6; CDF; BSF2; Interleukin 6 (Interferon, Beta 2); HGF; B-Cell Differentiation Factor; HSF; Truncated Interleukin 6; B-Cell Stimulatory Factor 2; Interferon, Beta 2; CTL Differ

  • AA Sequence

    PERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM

  • Predicted Molecular Mass

    21.2 kDa

  • Molecular Weight

    Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 15% Trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00