1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6
  5. IL-6 Protein, Pig

IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". IL-6 Protein, Pig is the recombinant pig-derived IL-6 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-6 protein is a multifunctional cytokine that participates in immune, regenerative and metabolic processes by binding to IL6R and forming a complex with IL6ST/gp130. This activates the IL6 signaling pathway, initiating "classical signaling" via membrane-bound IL6R and IL6ST, "trans signaling" via binding of IL6 and soluble IL6R to IL6ST, and "cluster signaling" via the IL6:IL6R complex ". IL-6 Protein, Pig is the recombinant pig-derived IL-6 protein, expressed by E. coli , with tag free.

Background

IL-6 Protein is a versatile cytokine involved in various immune, regenerative, and metabolic processes. It exerts its effects by binding to IL6R, leading to the formation of a complex with the signaling subunit IL6ST/gp130, which activates the intracellular IL6-signaling pathway. This interaction can trigger different types of signaling, including 'classic signaling' through the membrane-bound IL6R and IL6ST, 'trans-signaling' through the binding of IL6 and soluble IL6R to IL6ST, and 'cluster signaling' through IL6:IL6R complexes on transmitter cells activating IL6ST receptors on neighboring receiver cells. IL-6 is crucial for the acute phase response, playing a role in host defense during infection and tissue injury. However, excessive IL-6 production is implicated in disease pathology. It is synthesized by myeloid cells like macrophages and dendritic cells in response to pathogen recognition through toll-like receptors (TLRs). In the adaptive immune response, IL-6 is necessary for B cell differentiation into immunoglobulin-secreting cells and plays a significant role in the differentiation of CD4(+) T cell subsets. It is an essential factor for the development of T follicular helper (Tfh) cells, which are crucial for germinal-center formation, and for the induction of the Th17 lineage in naive CD4(+) T cells. Additionally, IL-6 is required for the proliferation and survival of myeloma cells and plasmablast cells.

Biological Activity

1.Measured by its binding ability in a functional ELISA. Immobilized sus scrofa (pig) IL6 at 2 μg/mL (100 μl/well) can bind Human IL-6R-His , the EC50 of Human IL-6R-His is 250-750 ng/mL.
2. Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is typically 1-5 ng/mL.

Species

Pig

Source

E. coli

Tag

Tag Free

Accession

P26893 (P29-M212)

Gene ID
Molecular Construction
N-term
IL-6 (P29-M212)
Accession # P26893
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-6; Interleukin HP-1; BSF2; HSF; IFNB2
AA Sequence

PERLEEDAKGDATSDKMLFTSPDKTEELIKYILGKISAMRKEMCEKYEKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMRITTGLVEFQIYLDYLQKEYESNKGNVEAVQISTKALIQTLRQKGKNPDKATTPNPTTNAGLLDKLQSQNEWMKNTKIILILRSLEDFLQFSLRAIRIM

Predicted Molecular Mass
21.2 kDa
Molecular Weight

Approximately 18-22 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 15% Trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-6 Protein, Pig

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6 Protein, Pig
Cat. No.:
HY-P73220
Quantity:
MCE Japan Authorized Agent: