ITPRIPL1 Protein, Mouse (HEK293, His)
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Help & FAQs
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
A2ASA8 (D23-G96)
-
Gene ID73338
-
Molecular Construction
-
N-term
-
ITPRIPL1 (D23-G96)
Accession # A2ASA8 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ITPRIPL1; Inositol 1,4,5-Trisphosphate Receptor-Interacting Protein-Like 1; Prev. KIAA1754L; Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1; D1B; Inositol 1,4,5-Triphosphate Receptor-Interacting Protein-Like 1; Inositol 1,4,5-Trisphosphat
-
AA Sequence
DRMDLDTLARSRQLEKRMSEEMRQLEMEFEERSRAAEQKQKVENFWRGDTSSDQLVLGKKDMGWPFQAGGQDGG
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
