JAM-A/CD321 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
The JAM-A/CD321 protein is critical for the formation of tight junctions in epithelial cells, participating in early junction development and recruiting PARD3. However, the formation of PARD6-PARD3 complex may hinder PARD3-JAM1 interaction, thus preventing tight junction assembly. JAM-A/CD321 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The JAM-A/CD321 protein is critical for the formation of tight junctions in epithelial cells, participating in early junction development and recruiting PARD3. However, the formation of PARD6-PARD3 complex may hinder PARD3-JAM1 interaction, thus preventing tight junction assembly. JAM-A/CD321 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag.
Background
The JAM-A/CD321 protein plays a crucial role in the formation of tight junctions in epithelial cells. It is involved in the early stages of cell junction development and recruits PARD3. However, the formation of the PARD6-PARD3 complex may hinder the interaction between PARD3 and JAM1, leading to the prevention of tight junction assembly. Moreover, JAM-A/CD321 is involved in regulating the transmigration of monocytes, which is essential for maintaining the integrity of the epithelial barrier. It also acts as a ligand for integrin alpha-L/beta-2, facilitating the transmigration of memory T-cells and neutrophils. Additionally, JAM-A/CD321 interacts with the ninth PDZ domain of MPDZ and the first PDZ domain of PARD3, with the association between PARD3 and PARD6B possibly disrupting this interaction. Furthermore, it interacts with ITGAL (via I-domain).
Verified Bioactivity
Measured by the ability of the immobilized protein to inhibit the adhesion of Vitronectin on HUVEC cells. The ED50 for this effect is 0.1574 μg/mL in the presence of 10 ng/mL Vitronectin. Corresponding to a specific activity is 6353.24 U/mg.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9JHY1 (K27-G238)
-
Molecular Construction
-
N-term
-
JAM-A (K27-G238)
Accession # Q9JHY1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
F11R; JAM-A; Prev. JAM1; JAMA; Junctional Adhesion Molecule 1; Platelet Adhesion Molecule 1; PAM-1; Platelet F11 Receptor; JCAM; CD321 Antigen; Junctional Adhesion Molecule A; JAM; JAM-1; KAT; F11 Receptor; CD321
-
AA Sequence
KGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGEVSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKTRAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGG
-
Molecular Weight
Approximately 28 kDa & 32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
