KAAG1 Protein, Human (His)
KAAG1 Protein, Human (His) is the recombinant human-derived KAAG1 protein, expressed by E. coli, with C-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KAAG1 Protein, Human (His) is the recombinant human-derived KAAG1 protein, expressed by E. coli, with C-6*His tag.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9UBP8 (M1-K84)
-
Gene ID/
-
Molecular Construction
-
N-term
-
Q9UBP8 KAAG1 (M1-K84)
Accession # -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
KAAG1; RU2 Antisense Gene Protein; Kidney Associated DCDC2 Antisense RNA 1; RU2; RU2AS; Kidney-Associated Antigen 1; Kidney Associated Antigen 1
-
AA Sequence
MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
-
Predicted Molecular Mass
15.9 kDa
-
Molecular Weight
Approximately 15.9 kDa,based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
