KCTD1 Protein, Human (sf9, His, StrepⅡ)

KCTD1 protein is a potential transcriptional regulator that inhibits AP-2 family members (TFAP2A, TFAP2B, TFAP2C). The formation of its homodimer indicates self-association, while the interaction with AP-2 members through the BTB domain emphasizes its role in complex molecular interactions. KCTD1 Protein, Human (sf9, His, Strep) is the recombinant human-derived KCTD1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

KCTD1 Protein emerges as a potential transcriptional regulator, implicated in the repression of AP-2 family members, including TFAP2A, TFAP2B, and TFAP2C, to varying extents. Its ability to form homodimers suggests a potential role in self-association, while its interaction with TFAP2A, TFAP2B, and TFAP2C via the BTB domain underscores its involvement in complex molecular interactions. The specific mechanisms through which KCTD1 modulates the transcriptional activity of AP-2 family members remain to be fully elucidated, prompting further investigation into its functional significance in gene expression regulation. The diverse interactions and potential regulatory roles of KCTD1 highlight its significance in orchestrating intricate transcriptional processes and warrant comprehensive studies to unravel the precise molecular pathways through which KCTD1 exerts its effects.

Human

Sf9 insect cells

N-StrepⅡ;N-8*His

Q719H9 (S2-D257)

284252

Partial

SRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.