KCTD1 Protein, Human (sf9, His, StrepⅡ)
KCTD1 protein is a potential transcriptional regulator that inhibits AP-2 family members (TFAP2A, TFAP2B, TFAP2C). The formation of its homodimer indicates self-association, while the interaction with AP-2 members through the BTB domain emphasizes its role in complex molecular interactions. KCTD1 Protein, Human (sf9, His, Strep) is the recombinant human-derived KCTD1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
KCTD1 protein is a potential transcriptional regulator that inhibits AP-2 family members (TFAP2A, TFAP2B, TFAP2C). The formation of its homodimer indicates self-association, while the interaction with AP-2 members through the BTB domain emphasizes its role in complex molecular interactions. KCTD1 Protein, Human (sf9, His, Strep) is the recombinant human-derived KCTD1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
KCTD1 Protein emerges as a potential transcriptional regulator, implicated in the repression of AP-2 family members, including TFAP2A, TFAP2B, and TFAP2C, to varying extents. Its ability to form homodimers suggests a potential role in self-association, while its interaction with TFAP2A, TFAP2B, and TFAP2C via the BTB domain underscores its involvement in complex molecular interactions. The specific mechanisms through which KCTD1 modulates the transcriptional activity of AP-2 family members remain to be fully elucidated, prompting further investigation into its functional significance in gene expression regulation. The diverse interactions and potential regulatory roles of KCTD1 highlight its significance in orchestrating intricate transcriptional processes and warrant comprehensive studies to unravel the precise molecular pathways through which KCTD1 exerts its effects.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
Q719H9 (S2-D257)
-
Gene ID284252
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
KCTD1 (S2-D257)
Accession # Q719H9 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
KCTD1; Potassium Channel Tetramerization Domain-Containing Protein 1; Prev. C18orf5; DNRD; BTB/POZ Domain-Containing Protein KCTD1; RMDA; Potassium Channel Tetramerization Domain Containing 1; Potassium Channel Tetramerisation Domain Containing 1
-
AA Sequence
SRPLITRSPASPLNNQGIPTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)