KGF/FGF-7 Protein, Human (Biotinylated, His-Avi)
KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7, Human (Biotinylated, His-Avi) is the recombinant human-derived KGF/FGF-7 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KGF/FGF-7 proteins coordinate embryonic development and regulate basic processes such as cell proliferation and differentiation. Its critical role extends to normal branching morphogenesis. KGF/FGF-7, Human (Biotinylated, His-Avi) is the recombinant human-derived KGF/FGF-7 protein, expressed by HEK293, with C-Avi;C-hFc labeled tag.
Background
KGF/FGF-7 Protein assumes a crucial role in orchestrating embryonic development, exhibiting regulatory control over fundamental processes encompassing cell proliferation and differentiation. Its essential contribution extends to the intricate realm of normal branching morphogenesis, where KGF/FGF-7 plays a pivotal role. As a growth factor specifically active on keratinocytes, it emerges as a potential major paracrine effector governing normal epithelial cell proliferation. The protein establishes key interactions, forming complexes with FGFBP1 and FGFR2, and its binding affinity with fibroblast growth factors (FGFs) and their receptors is augmented by heparan sulfate glycosaminoglycans, acting as critical coreceptors in these molecular interactions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
P21781-1 (C32-T194)
-
Gene ID2252
-
Molecular Construction
-
N-term
-
KGF/FGF-7 (C32-T194)
Accession # P21781-1 -
His-Avi
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Conjugation
Biotin
-
Synonyms
FGF7; HBGF-7; Fibroblast Growth Factor 7; FGF-7; KGF; Fibroblast Growth Factor 7 (Keratinocyte Growth Factor); Keratinocyte Growth Factor; Fibroblast Growth Factor; Heparin-Binding Growth Factor 7; FGF
-
AA Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
-
Predicted Molecular Mass
22.6 kDa
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
