Copy Link Print Information

KIR2DL2/CD158b1 Protein, Human (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

KIR2DL2/CD158b1, found on NK cells, functions as a receptor for HLA-Cw1, Cw3, Cw7, and Cw8 allotypes. Its key role is to inhibit NK cell activity, serving as a regulator to prevent cellular lysis. Interacting with specific HLA-C molecules, KIR2DL2/CD158b1 contributes to the delicate balance of inhibitory signals in the immune system, shaping the responsiveness of NK cells to potential targets. KIR2DL2/CD158b1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL2/CD158b1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • KIR2DL2/CD158b1 Protein, Human (HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KIR2DL2/CD158b1, found on NK cells, functions as a receptor for HLA-Cw1, Cw3, Cw7, and Cw8 allotypes. Its key role is to inhibit NK cell activity, serving as a regulator to prevent cellular lysis. Interacting with specific HLA-C molecules, KIR2DL2/CD158b1 contributes to the delicate balance of inhibitory signals in the immune system, shaping the responsiveness of NK cells to potential targets. KIR2DL2/CD158b1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived KIR2DL2/CD158b1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR2DL2/CD158b1, located on natural killer (NK) cells, serves as a receptor for HLA-Cw1, Cw3, Cw7, and Cw8 allotypes. Its primary function is to exert inhibitory effects on NK cell activity, acting as a regulator to prevent cellular lysis. Through specific interactions with distinct HLA-C molecules, KIR2DL2/CD158b1 contributes to the finely tuned balance of inhibitory signals within the immune system, influencing the responsiveness of NK cells to potential targets.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession

    P43627 (H22-H245)

  • Gene ID
    3803  [NCBI]
  • Molecular Construction
    • N-term
    • CD158b1 (H22-H245)
      Accession # P43627
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    KIR2DL2; Killer Cell Immunoglobulin-Like Receptor; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 2; Natural Killer Cell Inhibitory Receptor; Killer Cell Immunoglobulin-Like Receptor 2DL2; MHC Class I NK Cell Receptor;

  • AA Sequence

    HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH

  • Predicted Molecular Mass

    27.4 kDa

  • Molecular Weight

    Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • KIR2DL2/CD158b1 Protein, Human (HEK293, His-Avi) Product Image
    1/16
  • KIR2DL2/CD158b1 Protein, Human (HEK293, His-Avi) Product Image