KIR3DS1/CD158e2 Protein, Human (CHO, His)

KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.

KIR3DS1/CD158e2, situated on natural killer (NK) cells, functions as a receptor for MHC class I molecules. Its pivotal role involves triggering NK cell degranulation and promoting the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. The direct interaction with HLA-F open conformer underscores the specificity of this receptor-ligand engagement, highlighting KIR3DS1/CD158e2 as a key player in modulating NK cell responses, particularly in the context of anti-viral immune reactions.

Immobilized Human KIR3DS1, at 2 μg/mL (100μL/well) can bind Anti-KIR3DS1 antibody. The ED₅₀ for this effect is 0.9047 μg/mL.

• 
  Immobilized Human KIR3DS1, at 2 μg/mL (100 μL/well) can bind Anti-KIR3DS1 antibody. The ED₅₀ for this effect is 0.9047 μg/mL.

Human

CHO

C-6*His

Q14943-1 (H22-H340)

3813  [NCBI]

Extracellular Domain

HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH

Approximately 40-57 kDa due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.