KIR3DS1/CD158e2 Protein, Human (CHO, His)
Based on 1 Customer Validation
KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.
- Species: Human
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.
KIR3DS1/CD158e2, situated on natural killer (NK) cells, functions as a receptor for MHC class I molecules. Its pivotal role involves triggering NK cell degranulation and promoting the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. The direct interaction with HLA-F open conformer underscores the specificity of this receptor-ligand engagement, highlighting KIR3DS1/CD158e2 as a key player in modulating NK cell responses, particularly in the context of anti-viral immune reactions.
Immobilized Human KIR3DS1, at 2 μg/mL (100μL/well) can bind Anti-KIR3DS1 antibody. The ED50 for this effect is 0.9047 μg/mL.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-6*His
-
Accession
Q14943-1 (H22-H340)
-
Molecular Construction
-
N-term
-
CD158e2 (H22-H340)
Accession # Q14943 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KIR3DS1; Killer Cell Immunoglobulin-Like Receptor; Killer Cell Immunoglobulin Like Receptor, Three Ig Domains And Short Cytoplasmic Tail 1; Killer Cell Immunoglobulin Receptor; Killer Cell Immunoglobulin-Like Receptor, Three Domains, Short Cytoplasmic Tai
-
AA Sequence
HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH
-
Predicted Molecular Mass
35.2 kDa
-
Molecular Weight
Approximately 40-57 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
