Kremen-2 Protein, Mouse (HEK293, His)
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting LRP5 and LRP6 endocytosis. Its role in limb development ensures correct patterning and negatively affects bone formation. Kremen-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting LRP5 and LRP6 endocytosis. Its role in limb development ensures correct patterning and negatively affects bone formation. Kremen-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Kremen-2, functioning as a receptor for Dickkopf proteins, operates in collaboration with DKK1/2 to restrain Wnt/beta-catenin signaling by facilitating the endocytosis of Wnt receptors LRP5 and LRP6. This regulatory role extends to limb development, where Kremen-2 acts to attenuate Wnt signaling, ensuring the normal patterning of limbs and exerting a negative influence on bone formation. Additionally, Kremen-2 forms a ternary complex with DKK1 and LRP6, emphasizing its involvement in intricate molecular interactions crucial for modulating key signaling pathways. The interaction with ERLEC1 further underscores the multifaceted regulatory functions of Kremen-2 in cellular processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q8K1S7 (G25-S363)
-
Molecular Construction
-
N-term
-
Kremen-2 (G25-S363)
Accession # Q8K1S7 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KREMEN2; Kringle Domain-Containing Transmembrane Protein 2; Kringle Containing Transmembrane Protein 2; Dickkopf Receptor 2; KRM2; Kremen Protein 2; Kringle-Containing Protein Marking The Eye And The Nose; MGC10791
-
AA Sequence
GSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWSAPQGVIYSPDFPDEYGPDRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNLLRAFDGAHPPPPGPLRLRTAALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTESLAGDPDGANASCSPKPGAAQAS
-
Predicted Molecular Mass
37.4 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
