2. Recombinant Proteins
  3. Receptor Proteins
  4. Kremen-2 Protein, Mouse (HEK293, His)

Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting LRP5 and LRP6 endocytosis. Its role in limb development ensures correct patterning and negatively affects bone formation. Kremen-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting LRP5 and LRP6 endocytosis. Its role in limb development ensures correct patterning and negatively affects bone formation. Kremen-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
Background

Kremen-2, functioning as a receptor for Dickkopf proteins, operates in collaboration with DKK1/2 to restrain Wnt/beta-catenin signaling by facilitating the endocytosis of Wnt receptors LRP5 and LRP6. This regulatory role extends to limb development, where Kremen-2 acts to attenuate Wnt signaling, ensuring the normal patterning of limbs and exerting a negative influence on bone formation. Additionally, Kremen-2 forms a ternary complex with DKK1 and LRP6, emphasizing its involvement in intricate molecular interactions crucial for modulating key signaling pathways. The interaction with ERLEC1 further underscores the multifaceted regulatory functions of Kremen-2 in cellular processes.
Species

Mouse
Source

HEK293
Tag

C-8*His
Accession

Q8K1S7 (G25-S363)
Gene ID
Molecular Construction
N-term
Kremen-2 (G25-S363)
Accession # Q8K1S7
8*His
C-term
Protein Length

Extracellular Domain
Synonyms
KRM2; KREMEN2; Kremen-2; Dickkopf receptor 2
AA Sequence

GSLHSPGLSECFQVNGADYRGHQNYTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWSAPQGVIYSPDFPDEYGPDRNCSWVLGQLGAVLELTFRLFELADSRDRLELRDVSSGNLLRAFDGAHPPPPGPLRLRTAALLLTFRSDARGHAQGFALTYRGLQDTVEGRASPEDSTESLAGDPDGANASCSPKPGAAQAS

Predicted Molecular Mass
37.4 kDa
Peso molecular

Approximately 50-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.
Glycosylation
Yes
Pureza

≥ 95%, as determined by Bis-Tris PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentación
Instrucciones de manejo (2659 KB)

Kremen-2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Kremen-2 Protein, Mouse (HEK293, His)

  

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

      

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Kremen-2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P77977
Cantidad:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nombre del producto

  

Lot #

Nombre del solicitante *

 

Country or Region *

Direcciòn del E-mail *

     

Número de teléfono *

 

Nombre de la Organizaciòn *

Observaciones

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.