LAG-3 Protein, Human (Biotinylated, HEK293, mFc-Avi)

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LAG-3 (lymphocyte activating gene 3) protein is an inhibitory receptor on antigen-activated T cells and is critical for immune regulation. LAG-3 binds to FGL1 and transmits inhibitory signals that negatively affect CD8(+) and CD4(+) T cell proliferation, activation, and effector functions. LAG-3 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived LAG-3 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

Background

LAG-3 (Lymphocyte activation gene 3) protein, an inhibitory receptor present on antigen-activated T-cells, plays a crucial role in immune regulation. Upon binding to its major ligand, FGL1, LAG-3 delivers inhibitory signals that negatively regulate the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Acting in synergy with PDCD1/PD-1, LAG-3 may inhibit antigen-specific T-cell activation, particularly following T-cell receptor (TCR) engagement where it associates with CD3-TCR in the immunological synapse. Beyond its role in T-cell inhibition, LAG-3 is constitutively expressed on a subset of regulatory T-cells (Tregs), contributing to their suppressive function and mediating immune tolerance. Additionally, LAG-3 negatively regulates plasmacytoid dendritic cell (pDCs) activation and, intriguingly, interacts with MHC class II (MHC-II), potentially acting as both a ligand for MHC-II on antigen-presenting cells (APC) and a promoter of APC activation/maturation, thereby influencing Th1 immune response.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-mFc
  • Accession
  • Gene ID
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC

  • AA Sequence

    LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL

  • Predicted Molecular Mass

    75.4 kDa

  • Molecular Weight

    Approximately 100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00