Copy Link Print Information

LDLR Protein, Human (HEK293)

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293) is the recombinant human-derived LDLR protein, expressed by HEK293, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • LDLR Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

LDLR Protein plays a pivotal role in cholesterol homeostasis, binding to LDL and mediating cellular uptake through endocytosis. Clustering into clathrin-coated pits is essential for internalization. In microbial infection, LDLR acts as a receptor for hepatitis C virus in hepatocytes, emphasizing its dual functionality in cholesterol metabolism and the cellular response to viral infections. LDLR Protein, Human (HEK293) is the recombinant human-derived LDLR protein, expressed by HEK293, with tag free.

Background

The LDLR Protein serves as a crucial mediator in cholesterol homeostasis by binding to low-density lipoprotein (LDL), the primary cholesterol-carrying lipoprotein in plasma, and facilitating its cellular uptake through endocytosis. To enable internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, in the context of microbial infection, LDLR acts as a receptor for the hepatitis C virus within hepatocytes, although this interaction does not occur through a direct binding with viral proteins. This dual functionality underscores the diverse roles of LDLR in both cholesterol metabolism and the cellular response to viral infections.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    P01130-1 (A22-R788)

  • Gene ID
    3949
  • Molecular Construction
    • N-term
    • (A22-R788)
      Accession # P01130-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    LDLR; LDL Receptor; Low Density Lipoprotein Receptor; Low-Density Lipoprotein Receptor Class A Domain-Containing Protein 3; Low-Density Lipoprotein Receptor; Familial Hypercholesterolemia; LDLCQ2; Low Density Lipoprotein

  • AA Sequence

    AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWPQRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSSTAVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTMSHQALGDVAGRGNEKKPSSVR

  • Predicted Molecular Mass

    85.5 kDa

  • Molecular Weight

    Approximately 80-90 kDa & 110-120 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • LDLR Protein, Human (HEK293) Product Image
    1/16
  • LDLR Protein, Human (HEK293) Product Image