LGALSL Protein, Human (His)
The LGALSL protein was identified as a member of the galectin family, exhibits no affinity for lactose, and may not be involved in carbohydrate binding. This unique feature distinguishes LGALSL from typical galectins, which are known for their carbohydrate recognition domain and interaction with specific sugar moieties. LGALSL Protein, Human (His) is the recombinant human-derived LGALSL protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The LGALSL protein was identified as a member of the galectin family, exhibits no affinity for lactose, and may not be involved in carbohydrate binding. This unique feature distinguishes LGALSL from typical galectins, which are known for their carbohydrate recognition domain and interaction with specific sugar moieties. LGALSL Protein, Human (His) is the recombinant human-derived LGALSL protein, expressed by E. coli , with C-6*His labeled tag.
Background
LGALSL protein, based on available information, does not exhibit lactose-binding activity and may not bind carbohydrates. Lactose is a disaccharide sugar found in milk, and the lack of binding to lactose suggests a distinct functional role for LGALSL. Furthermore, LGALSL is described as a monomeric protein, indicating that it exists as a single, independent unit without forming complexes with other molecules. The absence of lactose binding and a potential lack of carbohydrate binding highlight the specificity and uniqueness of LGALSL's molecular interactions. Further investigations are warranted to elucidate the precise functions and biological significance associated with LGALSL, shedding light on its role within cellular processes and potential implications in various physiological contexts. (
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q3ZCW2 (A2-G172)
-
Molecular Construction
-
N-term
-
LGALSL (A2-G172)
Accession # Q3ZCW2 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LGALSL; Lectin Galactoside-Binding-Like Protein; Galectin Like; Galectin-Like Protein; GRP; Lectin, Galactoside-Binding-Like; Galectin-Related Protein; Lectin, Galactoside Binding Like; HSPC159; Galectin
-
AA Sequence
AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
