1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Neurotrophic Factors
  4. Leukemia Inhibitory Factor
  5. LIF Protein, Human (Biotinylated, HEK293, His-Avi)

LIF Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78843
Handling Instructions Technical Support

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LIF protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LIF protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The LIF protein possesses the capacity to induce terminal differentiation in leukemic cells. Its diverse range of activities encompasses the induction of hematopoietic differentiation in both normal and myeloid leukemia cells, prompting neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. These multifaceted activities underscore LIF's role in influencing cellular differentiation across various cell types and physiological contexts.

Biological Activity

Immobilized Biotinylated Human LIF His-Avi on SA-coated surface at 1 μg/mL (100 μL/well) can bind Human LIF R Fc with a linear range of 1-31 ng/mL.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

P15018-1 (S23-F202)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
LIF; CDF; DIA; HILDA; MLPLI
AA Sequence

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Predicted Molecular Mass
23.4 kDa
Molecular Weight

Approximately 37-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LIF Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LIF Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LIF Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78843
Quantity:
MCE Japan Authorized Agent: