LIF Protein, Human (Biotinylated, HEK293, His-Avi)

LIF protein induces terminal differentiation in leukemic cells, promoting hematopoietic and neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. Its diverse activities highlight its role in influencing cellular differentiation across various cell types and physiological contexts. LIF Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LIF protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

The LIF protein possesses the capacity to induce terminal differentiation in leukemic cells. Its diverse range of activities encompasses the induction of hematopoietic differentiation in both normal and myeloid leukemia cells, prompting neuronal cell differentiation, and stimulating acute-phase protein synthesis in hepatocytes. These multifaceted activities underscore LIF's role in influencing cellular differentiation across various cell types and physiological contexts.

Immobilized Biotinylated Human LIF His-Avi on SA-coated surface at 1 μg/mL (100 μL/well) can bind Human LIF R Fc with a linear range of 1-31 ng/mL.

Human

HEK293

C-Avi;C-His

P15018-1 (S23-F202)

3976  [NCBI]

Full Length of Mature Protein

Biotin

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Approximately 37-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.