1. Recombinant Proteins
  2. Others
  3. LSM3 Protein, Human (His)

The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.

Background

LSM3 protein serves a pivotal role in pre-mRNA splicing as a crucial component of the U4/U6-U5 tri-snRNP complex, which participates in spliceosome assembly and the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex, in which LSM3 is a constituent, specifically binds to the 3'-terminal U-tract of U6 snRNA. This intricate machinery, composed of various snRNPs and associated proteins, including LSM3, LSM2, LSM4, LSM5, LSM6, LSM7, and LSM8, forms a ring-shaped subcomplex within the U4/U6-U5 tri-snRNP complex. These interactions emphasize LSM3's essential contribution to the complex orchestration of spliceosome assembly and pre-mRNA processing.

Species

Human

Source

E. coli

Tag

N-His

Accession

P62310 /NP_055278.1(M1-G102)

Gene ID
Molecular Construction
N-term
His
/NP_055278.1(M1-G102)LSM3P62310 /NP_055278.1(M1-G102)
Accession # P62310
C-term
Protein Length

Full Length

Synonyms
U6 snRNA-associated Sm-like protein LSm3; LSM3; MDS017
AA Sequence

MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG

Molecular Weight

Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LSM3 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LSM3 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LSM3 Protein, Human (His)
Cat. No.:
HY-P75915
Quantity:
MCE Japan Authorized Agent: