LSM3 Protein, Human (His)
Based on 1 Customer Validation
The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The LSM3 protein plays a crucial role in pre-mRNA splicing as a component of the U4/U6-U5 tri-snRNP complex involved in spliceosome assembly and as part of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex (including LSM3) specifically binds to the 3'-end U strand of U6 snRNA. LSM3 Protein, Human (His) is the recombinant human-derived LSM3 protein, expressed by E. coli , with N-His labeled tag.
LSM3 protein serves a pivotal role in pre-mRNA splicing as a crucial component of the U4/U6-U5 tri-snRNP complex, which participates in spliceosome assembly and the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex, in which LSM3 is a constituent, specifically binds to the 3'-terminal U-tract of U6 snRNA. This intricate machinery, composed of various snRNPs and associated proteins, including LSM3, LSM2, LSM4, LSM5, LSM6, LSM7, and LSM8, forms a ring-shaped subcomplex within the U4/U6-U5 tri-snRNP complex. These interactions emphasize LSM3's essential contribution to the complex orchestration of spliceosome assembly and pre-mRNA processing.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P62310 /NP_055278.1(M1-G102)
-
Molecular Construction
-
N-term
-
His
-
/NP_055278.1(M1-G102)LSM3P62310 /NP_055278.1(M1-G102)
Accession # P62310 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
LSM3; USS2; LSM3 Homolog, U6 Small Nuclear RNA And MRNA Degradation Associated; LSM3 Homolog, U6 Small Nuclear RNA Associated (S. Cerevisiae); U6 SnRNA-Associated Sm-Like Protein LSm3; LSM3 U6 Small Nuclear RNA And MRNA Degradation Associated; YLR438C; LS
-
AA Sequence
MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKRNIPMLFVRGDGVVLVAPPLRVG
-
Molecular Weight
Approximately 14-18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
