LYG1 Protein, Human (sf9, His)
LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes. LYG1 Protein, Human (sf9, His) is the recombinant human-derived LYG1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes[1][2]. LYG1 Protein, Human (sf9, His) is the recombinant human-derived LYG1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells[1]. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes[2].
Human LYG1 is highly expressed in the kidneys and testes[3]. But rat LYG1 is highly expressed in the gingiva, and mouse LYG1 is highly expressed in the stomach[4]. Human LYG1 shares about 70% aa sequence identity with mouse and rat. Rat LYG1 shares about 95% aa sequence identity with mouse.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q8N1E2 (S20-F194)
-
Molecular Construction
-
N-term
-
LYG1 (S20-F194)
Accession # Q8N1E2 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LYG1; LYGA1; Lysozyme G1; Lysozyme G-Like Protein 1; SALW1939; Lysozyme G-Like 1
-
AA Sequence
SNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF
-
Predicted Molecular Mass
20.8 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
