1. Recombinant Proteins
  2. Others
  3. LYG1 Protein, Human (sf9, His)

LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes. LYG1 Protein, Human (sf9, His) is the recombinant human-derived LYG1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes[1][2]. LYG1 Protein, Human (sf9, His) is the recombinant human-derived LYG1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells[1]. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes[2].
Human LYG1 is highly expressed in the kidneys and testes[3]. But rat LYG1 is highly expressed in the gingiva, and mouse LYG1 is highly expressed in the stomach[4]. Human LYG1 shares about 70% aa sequence identity with mouse and rat. Rat LYG1 shares about 95% aa sequence identity with mouse.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q8N1E2 (S20-F194)

Gene ID
Molecular Construction
N-term
LYG1 (S20-F194)
Accession # Q8N1E2
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lysozyme g-like protein 1; LYG1
AA Sequence

SNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF

Predicted Molecular Mass
20.8 kDa
Molecular Weight

Approximately 22 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LYG1 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LYG1 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LYG1 Protein, Human (sf9, His)
Cat. No.:
HY-P77070
Quantity:
MCE Japan Authorized Agent: