1. Recombinant Proteins
  2. Others
  3. LYG1 Protein, Human (sf9, His)

LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes. LYG1 Protein, Human (sf9, His) is the recombinant human-derived LYG1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes[1][2]. LYG1 Protein, Human (sf9, His) is the recombinant human-derived LYG1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

LYG1, a classical secretory protein, belongs to the lysozyme G family. LYG1 inhibits tumor growth by promoting the activation, proliferation, and function of CD4+ T cells[1]. LYG1 also has a hydrolase activity and is involved in the degradation of peptidoglycans from bacterial membranes[2].
Human LYG1 is highly expressed in the kidneys and testes[3]. But rat LYG1 is highly expressed in the gingiva, and mouse LYG1 is highly expressed in the stomach[4]. Human LYG1 shares about 70% aa sequence identity with mouse and rat. Rat LYG1 shares about 95% aa sequence identity with mouse.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q8N1E2 (S20-F194)

Gene ID
Molecular Construction
N-term
LYG1 (S20-F194)
Accession # Q8N1E2
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lysozyme g-like protein 1; LYG1
AA Sequence

SNWGCYGNIQSLDTPGASCGIGRRHGLNYCGVRASERLAEIDMPYLLKYQPMMQTIGQKYCMDPAVIAGVLSRKSPGDKILVNMGDRTSMVQDPGSQAPTSWISESQVSQTTEVLTTRIKEIQRRFPTWTPDQYLRGGLCAYSGGAGYVRSSQDLSCDFCNDVLARAKYLKRHGF

Predicted Molecular Mass
20.8 kDa
분자량

Approximately 22 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

LYG1 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

LYG1 Protein, Human (sf9, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
LYG1 Protein, Human (sf9, His)
Cat. No.:
HY-P77070
수량:
MCE Japan Authorized Agent: