LYPD1 Protein, Human (HEK293, His)
LYPD1 Protein, Human (HEK293, His) is the recombinant human-derived LYPD1 protein, expressed by HEK293, with C-His tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LYPD1 Protein, Human (HEK293, His) is the recombinant human-derived LYPD1 protein, expressed by HEK293, with C-His tag.
Background
LYPD1 is believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro, it increases receptor desensitization and decreases affinity for ACh of alpha-4:beta-2-containing nAChRs. It may play a role in the intracellular trafficking of alpha-4:beta-2 and alpha-7-containing nAChRs and may inhibit their expression at the cell surface. Additionally, LYPD1 may be involved in the control of anxiety. by similar: Other studies suggest that LYPD1 might influence neural signaling by modulating nAChRs function.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q8N2G4-1 (L21-G115)
-
Gene ID116372
-
Molecular Construction
-
N-term
-
LYPD1 (L21-G115)
Accession # Q8N2G4-1 -
His
-
C-term
-
-
Protein Length
Full Length of Ly6/PLAUR domain-containing protein 1 Chain
-
Synonyms
LYPD1; Putative HeLa Tumor Suppressor; Prev. LYPDC1; MGC29643; PHTS; Lynx2; LY6/PLAUR Domain Containing 1; Ly6/PLAUR Domain-Containing Protein 1
-
AA Sequence
LQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRG
-
Predicted Molecular Mass
12.4 kDa
-
Molecular Weight
Approximately 18-20 kDa & 40-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
