Lysozyme 2/LYZL2 Protein, Human (sf9, His)
Lysozyme 2/LYZL2 Protein, with catalytic activity, hydrolyzes (1->4)-beta-linkages in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Its enzymatic properties involve cleaving these bonds, emphasizing its role in degrading bacterial cell walls and chitinous substances through lytic actions on these structural components. Lysozyme 2/LYZL2 Protein, Human (sf9, His) is the recombinant human-derived Lysozyme 2/LYZL2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Lysozyme 2/LYZL2 Protein, with catalytic activity, hydrolyzes (1->4)-beta-linkages in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Its enzymatic properties involve cleaving these bonds, emphasizing its role in degrading bacterial cell walls and chitinous substances through lytic actions on these structural components. Lysozyme 2/LYZL2 Protein, Human (sf9, His) is the recombinant human-derived Lysozyme 2/LYZL2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Lysozyme 2/LYZL2 Protein exhibits catalytic activity, specifically hydrolyzing (1->4)-beta-linkages within peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins. Its enzymatic properties involve the cleavage of these specific chemical bonds, highlighting its role in the degradation of bacterial cell walls and chitinous substances through its lytic actions on these structural components.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q7Z4W2-1 (K20-S148)
-
Gene ID119180 [NCBI]
-
Molecular Construction
-
N-term
-
LYZL2 (K20-S148)
Accession # Q7Z4W2-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LYZL2; Lysozyme D2; Lysozyme Like 2; Lysozyme-2; Lysozyme-Like Protein 2; LYZD2; Lysozyme-Like 2
-
AA Sequence
KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
-
Predicted Molecular Mass
16.3 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
