1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Lysozyme 2/LYZL2 Protein, Human (sf9, His)

Lysozyme 2/LYZL2 Protein, with catalytic activity, hydrolyzes (1->4)-beta-linkages in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Its enzymatic properties involve cleaving these bonds, emphasizing its role in degrading bacterial cell walls and chitinous substances through lytic actions on these structural components. Lysozyme 2/LYZL2 Protein, Human (sf9, His) is the recombinant human-derived Lysozyme 2/LYZL2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Lysozyme 2/LYZL2 Protein, with catalytic activity, hydrolyzes (1->4)-beta-linkages in peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins. Its enzymatic properties involve cleaving these bonds, emphasizing its role in degrading bacterial cell walls and chitinous substances through lytic actions on these structural components. Lysozyme 2/LYZL2 Protein, Human (sf9, His) is the recombinant human-derived Lysozyme 2/LYZL2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Lysozyme 2/LYZL2 Protein exhibits catalytic activity, specifically hydrolyzing (1->4)-beta-linkages within peptidoglycan, as well as between N-acetyl-D-glucosamine residues in chitodextrins. Its enzymatic properties involve the cleavage of these specific chemical bonds, highlighting its role in the degradation of bacterial cell walls and chitinous substances through its lytic actions on these structural components.

Species

Human

Source

Sf9 insect cells

Tag

C-His

Accession

Q7Z4W2-1 (K20-S148)

Gene ID

119180  [NCBI]

Molecular Construction
N-term
LYZL2 (K20-S148)
Accession # Q7Z4W2-1
His
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Lysozyme-like protein 2; Lysozyme-2; LYZL2
AA Sequence

KIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS

Predicted Molecular Mass
16.3 kDa
Molecular Weight

Approximately 19 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Lysozyme 2/LYZL2 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Lysozyme 2/LYZL2 Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Lysozyme 2/LYZL2 Protein, Human (sf9, His)
Cat. No.:
HY-P73834
Quantity:
MCE Japan Authorized Agent: