M1R Protein, Monkeypox virus (HEK293, His)
M1R Protein, Monkeypox virus (HEK293, His) is the recombinant virus-derived M1R protein, expressed by HEK293, with C-His tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
M1R Protein, Monkeypox virus (HEK293, His) is the recombinant virus-derived M1R protein, expressed by HEK293, with C-His tag.
Background
M1R is a muscarinic acetylcholine receptor that mediates various cellular responses, primarily through the action of G proteins, including inhibition of adenylate cyclase, breakdown of phosphoinositides, and modulation of potassium channels. Its primary transducing effect is Pi turnover.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-8*His
-
Accession
QJQ40223 (G2-G183)
-
Protein Length
Partial
-
Synonyms
M1R
-
AA Sequence
GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNITVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPRQVAGTG
-
Predicted Molecular Mass
20.4 kDa
-
Molecular Weight
Approximately 23-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
