MASP1 Protein, Mouse (HEK293, His)
MASP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MASP1 protein, expressed by HEK293, with C-His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MASP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MASP1 protein, expressed by HEK293, with C-His tag.
Background
MASP1 functions in the lectin pathway of complement, which plays a key role in innate immunity by recognizing pathogens through sugar moiety patterns. The pathway is triggered when mannan-binding lectin (MBL) and ficolins bind to sugar moieties, leading to activation of associated proteases MASP1 and MASP2. It acts as an endopeptidase and may activate MASP2 or C2, or directly activate C3, the central component of the complement cascade. Isoform 2 may inhibit lectin pathway activation or cleave IGFBP5. MASP1 also contributes to developmental processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P98064-2 (I455-R733)
-
Gene ID17174
-
Molecular Construction
-
N-term
-
MASP1 (I455-R733)
Accession # P98064-2 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MASP1; Mannan-Binding Lectin Serine Protease 1; Prev. CRARF; Serine Protease 5; Prev. PRSS5; CRARF1; Mannose-Binding Lectin-Associated Serine Protease 1; RaRF; MASP-3; Mannan-Binding Lectin Serine Peptidase 1 (C4/C2 Activating Component Of Ra-Reactive Fac
-
AA Sequence
IIGGRNAELGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVILHPDFNIQNYNHDIALVQLQKPVPLGAHVMPICLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIILSGTRTLSDVLQYVKLPVVSHAECKASYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDEMSQHWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEEMNSPRAVRDLQVER
-
Predicted Molecular Mass
32.6 kDa
-
Molecular Weight
Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
