MASP1 Protein, Mouse (HEK293, His)

MASP1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MASP1 protein, expressed by HEK293, with C-His tag.

MASP1 functions in the lectin pathway of complement, which plays a key role in innate immunity by recognizing pathogens through sugar moiety patterns. The pathway is triggered when mannan-binding lectin (MBL) and ficolins bind to sugar moieties, leading to activation of associated proteases MASP1 and MASP2. It acts as an endopeptidase and may activate MASP2 or C2, or directly activate C3, the central component of the complement cascade. Isoform 2 may inhibit lectin pathway activation or cleave IGFBP5. MASP1 also contributes to developmental processes.

Mouse

HEK293

C-His

P98064-2 (I455-R733)

17174

Partial

IGGRNAELGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWILTAAHVLRSQRRDNTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARVILHPDFNIQNYNHDIALVQLQKPVPLGAHVMPICLPRPEPEGPAPHMLGLVAGWGISNPNVTVDEIILSGTRTLSDVLQYVKLPVVSHAECKASYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVIFDEMSQHWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEEMNSPRAVRDLQVER

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution in 50 mM Tris, 150 mM NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.