Matriptase/ST14 Catalytic Domain Protein, Mouse (His)

The Matriptase/ST14 catalytic domain protein exhibits serine-type endopeptidase activity and is critical in processes as diverse as placental branching and neural tube closure. It is an extrinsic component of the plasma membrane and is expressed in structures such as the digestive system, early concepts, genitourinary system, pituitary gland, and sense organs. Matriptase/ST14 Catalytic Domain Protein, Mouse (His) is the recombinant mouse-derived Matriptase/ST14 Catalytic Domain protein, expressed by E. coli , with N-6*His labeled tag.

The catalytic domain of Matriptase/ST14 protein exhibits serine-type endopeptidase activity and plays a crucial role upstream of various processes, including epithelial cell morphogenesis involved in placental branching and neural tube closure. Located in the extracellular region as an extrinsic component of the plasma membrane, this protein is expressed in diverse structures, such as the alimentary system, early conceptus, genitourinary system, pituitary gland, and sensory organ. Investigations into Matriptase/ST14 function have implications for understanding its involvement in physiological processes and may contribute to insights into conditions such as Sjogren's syndrome. The human ortholog of this gene, ST14 (ST14 transmembrane serine protease matriptase), is implicated in autosomal recessive congenital ichthyosis 11, highlighting its potential significance in genetic disorders.

Measured by its ability to cleave the fluorogenic peptide substrate BOC-Gln-Ala-Arg-AMC (HY-134432A) that incubate at room temperature for 5 min. The specific activity is 16782.82 pmol/min/µg.

Mouse

E. coli

N-6*His

NP_035306 (G596-V855)

19143

Partial

GSDEKNCDCGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCFQDDKNFKYSDYTMWTAFLGLLDQSKRSASGVQELKLKRIITHPSFNDFTFDYDIALLELEKSVEYSTVVRPICLPDATHVFPAGKAIWVTGWGHTKEGGTGALILQKGEIRVINQTTCEDLMPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSAEKDGRMFQAGVVSWGEGCAQRNKPGVYTRLPVVRDWIKEHTGV

Approximately 28 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.