MCP-2/CCL8 Protein, Human (His)
MCP-2/CCL8 Protein, Human (His) is the recombinant human-derived MCP-2/CCL8 protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MCP-2/CCL8 Protein, Human (His) is the recombinant human-derived MCP-2/CCL8 protein, expressed by E. coli, with N-His tag.
Background
MCP-2/CCL8 is a chemotactic factor that attracts monocytes, lymphocytes, basophils, and eosinophils. It may play a role in neoplasia and inflammatory host responses. This protein can bind heparin. The processed form MCP-2(6-76) does not exhibit monocyte chemotactic activity but inhibits the chemotactic effect most predominantly of CCL7, as well as CCL2, CCL5, and CCL8. by similar: The protein shares functional similarities with other members of the chemokine family, but its processed form exhibits unique inhibitory effects.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P80075 (Q24-P99)
-
Gene ID6355
-
Molecular Construction
-
N-term
-
His
-
CCL8 (Q24-P99)
Accession # P80075 -
C-term
-
-
Protein Length
Full Length of C-C motif chemokine 8 Chain
-
Synonyms
CCL8; Chemokine (C-C Motif) Ligand 8; Prev. SCYA8; Small-Inducible Cytokine A8; MCP-2; C-C Motif Chemokine 8; HC14; SCYA10; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 8 (Monocyte Chemotactic Protein 2); MCP2; Monocyte Chemoattractant Protein 2
-
AA Sequence
QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
-
Predicted Molecular Mass
10.9 kDa
-
Molecular Weight
Approximately 10-11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
