MD-2/LY96 Protein, Human (142a.a, His)
Based on 1 publication(s) in Google Scholar
MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD-2/LY96 Protein, Human (142a.a, His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD-2/LY96 Protein, Human (142a.a, His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.
Background
MD2 Protein, a key player in the innate immune response, serves as a critical component in recognizing bacterial lipopolysaccharide (LPS) and coordinating immune reactions. It binds directly to LPS and collaborates with TLR4 to elicit the innate immune response to bacterial LPS. Moreover, MD2 works in tandem with TLR2, responding to cell wall components from both Gram-positive and Gram-negative bacteria. MD2's interaction with TLR4 enhances NF-kappa-B activation, emphasizing its role in signaling pathways. In cell contexts expressing both LY96 and TLR4, MD2 enables responsiveness to LPS, underlining its importance in the cellular recognition of bacterial components. Structurally, MD2 forms a heterogeneous homomer from homodimers linked by disulfide bonds and is a crucial component of the lipopolysaccharide (LPS) receptor complex, which includes at least CD14, LY96, and TLR4. MD2's ligand binding induces interactions with TLR4 and promotes the oligomerization of the complex, further highlighting its central role in the immune response to bacterial challenges.
Verified Bioactivity
Immobilized Human TLR-4 at 2 μg/mL (100 μL/well) can bind Biotinylated Human MD2. The ED50 for this effect is 0.08207 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-8*His
-
Accession
Q9Y6Y9-1 (Q19-N160)
-
Molecular Construction
-
N-term
-
MD2 (Q19-N160)
Accession # Q9Y6Y9-1 -
8*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
LY96; Ly-96; Lymphocyte Antigen 96; MD2; MD-2; Myeloid Differentiation Protein-2; Protein MD-2; MD-2 Mimetic Protein Variant; ESOP-1; ESOP1
-
AA Sequence
QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
-
Predicted Molecular Mass
18 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 4 mM HCL, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)