MDH1 Protein, Human (His)
Based on 1 Customer Validation
Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Multiple studies have shown that the MDH1 protein plays a crucial role in cellular metabolism, catalyzing the reduction of aromatic α-keto acids in the presence of NADH. It plays an important role in the malate-aspartate shuttle and the tricarboxylic acid cycle, which is essential for supplying mitochondrial NADH for oxidative phosphorylation. MDH1 Protein, Human (His) is the recombinant human-derived MDH1 protein, expressed by E. coli , with C-6*His labeled tag.
Background
The MDH1 protein, also known as malate dehydrogenase 1, plays multifaceted roles in cellular metabolism. It catalyzes the reduction of aromatic alpha-keto acids in the presence of NADH, a process integral to various metabolic pathways. MDH1 is crucial for the malate-aspartate shuttle and the tricarboxylic acid cycle, contributing to the supply of mitochondrial NADH for oxidative phosphorylation, a key step in cellular energy production. Additionally, MDH1 catalyzes the reduction of 2-oxoglutarate to 2-hydroxyglutarate, a reaction associated with elevated reactive oxygen species (ROS). The intricate functions of MDH1 highlight its significance in maintaining cellular redox balance, energy metabolism, and the regulation of reactive oxygen species.
Verified Bioactivity
Measured by its ability to produce malate from oxaloacetate that incubate at room temperature in kinetic mode for 6 minutes. The specific activity is 58949.627 pmol/min/µg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P40925-1 (S2-A334)
-
Molecular Construction
-
N-term
-
MDH1 (S2-A334)
Accession # P40925-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MDH1; Diiodophenylpyruvate Reductase; Malate Dehydrogenase 1; Soluble Malate Dehydrogenase; Aromatic Alpha-Keto Acid Reductase; Malate Dehydrogenase; Malate Dehydrogenase, Cytoplasmic; HEL-S-32; Cytosolic Malate Dehydrogenase; MGC:1375; Malate Dehydrogena
-
AA Sequence
SEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
-
Molecular Weight
Approximately 36 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
