MECR Protein, Human (HEK293, His)
Based on 1 Customer Validation
MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MECR Protein, Human (HEK293, His) is the recombinant human-derived MECR protein, expressed by HEK293, with C-6*His labeled tag.
Background
Mitochondrial trans-2-enoyl-CoA reductase (MECR) is an oxidoreductase that catalyzes the last step in mitochondrial fatty acid synthesis (mtFAS). MECR catalyzes the NADPH-dependent reduction of trans-2-enoyl thioesters in mitochondrial fatty acid synthesis (fatty acid synthesis type II). Fatty acid chain elongation in mitochondria uses acyl carrier protein (ACP) as an acyl group carrier, but MECR accepts both ACP and CoA thioesters as substrates in vitro. MECR provides octanoyl chain for lipoic acid biosynthesis, regulating protein lipoylation and mitochondrial respiratory activity. Knockdown of MECR inhibits cell proliferation and colony formation, promotes apoptosis, and inhibits metastasis in HCC cell lines BEL-7404. In addition, MECR mutations cause childhood-onset dystonia and optic atrophy[1][2][3][4][5][6].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH01419.1 (P54-M373)
-
Molecular Construction
-
N-term
-
MECR (P54-M373)
Accession # AAH01419.1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Enoyl-[acyl-carrier-protein] reductase, mitochondrial Chain
-
Synonyms
MECR; 2-Enoyl Thioester Reductase; Mitochondrial Trans-2-Enoyl-CoA Reductase; Homolog Of Yeast 2-Enoyl Thioester Reductase; CGI-63; Trans-2-Enoyl-CoA Reductase, Mitochondrial; FASN2B; Nuclear Receptor-Binding Factor 1; NRBF1; HsNrbf-1; ETR1; DYTOABG; Enoy
-
AA Sequence
PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM
-
Predicted Molecular Mass
35.7 kDa
-
Molecular Weight
Approximately 39 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
