MESDC2 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The MESDC2 protein acts as a chaperone and plays a specific role in promoting the folding of the β-propeller/EGF module within the low-density lipoprotein receptor (LDLR) family.In addition to participating in LDLR folding, MESDC2 acts as an important regulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, thereby affecting Wnt signaling.MESDC2 Protein, Human (HEK293, His) is the recombinant human-derived MESDC2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The MESDC2 protein acts as a chaperone and plays a specific role in promoting the folding of the β-propeller/EGF module within the low-density lipoprotein receptor (LDLR) family.In addition to participating in LDLR folding, MESDC2 acts as an important regulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, thereby affecting Wnt signaling.MESDC2 Protein, Human (HEK293, His) is the recombinant human-derived MESDC2 protein, expressed by HEK293 , with C-His labeled tag.
MESDC2 protein serves as a chaperone with specific roles in facilitating the folding of beta-propeller/EGF modules within the low-density lipoprotein receptor (LDLR) family. Beyond its involvement in LDLR folding, MESDC2 acts as a crucial modulator of the Wnt pathway by chaperoning the coreceptors LRP5 and LRP6 to the plasma membrane, influencing Wnt signaling (PubMed:17488095). In embryonic development, MESDC2 plays an essential role in specifying polarity and inducing mesoderm formation. Additionally, it contributes significantly to neuromuscular junction (NMJ) formation by promoting the cell-surface expression of LRP4 (By similarity). The protein may also regulate the phagocytosis of apoptotic retinal pigment epithelium (RPE) cells (By similarity). As a monomer, MESDC2 interacts with LRP5 and LRP6, preventing their aggregation and guiding them to the plasma membrane. Furthermore, MESDC2 interacts with LRP4, promoting glycosylation and cell-surface expression of LRP4 (By similarity).
Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 2-8 µg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q14696-1 (A34-K230)
-
Molecular Construction
-
N-term
-
MESDC2 (A34-K230)
Accession # Q14696 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MESD; KIAA0081; Prev. MESDC2; Mesoderm Development LRP Chaperone MESD; Mesoderm Development Candidate 2; Renal Carcinoma Antigen NY-REN-61; Mesoderm Development Protein; MESDM; LDLR Chaperone MESD; OI20; LRP Chaperone MESD; Mesoderm Development LRP Chaper
-
AA Sequence
AEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNK
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
