MINDY2 Protein, Human (GST)
MINDY2 Protein, Human (GST) is the recombinant human-derived MINDY2, expressed by E. coli , with GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MINDY2 Protein, Human (GST) is the recombinant human-derived MINDY2, expressed by E. coli , with GST labeled tag. ,
Background
MINDY2 is a hydrolase that removes 'Lys-48'-linked ubiquitin chains from proteins and binds to polyubiquitin chains with various linkage types, including 'Lys-6', 'Lys-11', 'Lys-29', 'Lys-33', 'Lys-48', and 'Lys-63'. It may play a regulatory role in protein turnover. by similar: Its function is related to the regulation of the ubiquitin-proteasome system.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag GST
-
Accession
Q8NBR6-1 (S241-V504)
-
Gene ID54629
-
Protein Length
Partial
-
Synonyms
MINDY2; Family With Sequence Similarity 63 Member B; Prev. FAM63B; MINDY Deubiquitinase 2; KIAA1164; Protein FAM63B; Ubiquitin Carboxyl-Terminal Hydrolase MINDY-2; Ubiquitin Carboxyl-Terminal Hydrolase; MINDY Lysine 48 Deubiquitinase 2; Deubiquitinating E
-
AA Sequence
SVYHIKWIQWKEENTPIITQNENGPCPLLAILNVLLLAWKVKLPPMMEIITAEQLMEYLGDYMLDAKPKEISEIQRLNYEQNMSDAMAILHKLQTGLDVNVRFTGVRVFEYTPECIVFDLLDIPLYHGWLVDPQIDDIVKAVGNCSYNQLVEKIISCKQSDNSELVSEGFVAEQFLNNTATQLTYHGLCELTSTVQEGELCVFFRNNHFSTMTKYKGQLYLLVTDQGFLTEEKVVWESLHNVDGDGNFCDSEFHLRPPSDPETV
-
Predicted Molecular Mass
56.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
