MIP-3 beta/CCL19 Protein, Human (HEK293)

The MIP-3 beta/CCL19 protein exhibits multifaceted effects affecting lymphocyte recycling, homing, and immune responses. It is involved in T cell trafficking in the thymus and guides T cells and B cells to secondary lymphoid organs by binding to CCR7. MIP-3 beta/CCL19 Protein, Human (HEK293) is the recombinant human-derived MIP-3 beta/CCL19 protein, expressed by HEK293, with tag free.

MIP-3 beta/CCL19 Protein is suggested to have a multifaceted role, extending beyond inflammatory and immunological responses to encompass normal lymphocyte recirculation and homing. Its potential involvement in the trafficking of T-cells in the thymus, as well as the migration of both T-cells and B-cells to secondary lymphoid organs, underscores its importance in orchestrating cellular movements crucial for immune surveillance and responses. Acting through its binding to the chemokine receptor CCR7, MIP-3 beta/CCL19 demonstrates potent chemotactic activity specifically for T-cells and B-cells, excluding granulocytes and monocytes from its recruitment. Furthermore, it binds to the atypical chemokine receptor ACKR4, facilitating the recruitment of beta-arrestin (ARRB1/2) to ACKR4. Notably, MIP-3 beta/CCL19 interacts with TNFAIP6 via its Link domain, adding another layer to its complex network of molecular associations. The diverse functions of MIP-3 beta/CCL19 highlight its pivotal role in immune cell dynamics and underscore the need for comprehensive exploration into its regulatory mechanisms.

Human

HEK293

Tag Free

Q99731 (G22-S98)

6363

Full Length of Mature Protein

GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

Approximately 11-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.