MIP-3 beta/CCL19 Protein, Human (HEK293)
Based on 1 Customer Validation
The MIP-3 beta/CCL19 protein exhibits multifaceted effects affecting lymphocyte recycling, homing, and immune responses. It is involved in T cell trafficking in the thymus and guides T cells and B cells to secondary lymphoid organs by binding to CCR7. MIP-3 beta/CCL19 Protein, Human (HEK293) is the recombinant human-derived MIP-3 beta/CCL19 protein, expressed by HEK293, with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MIP-3 beta/CCL19 protein exhibits multifaceted effects affecting lymphocyte recycling, homing, and immune responses. It is involved in T cell trafficking in the thymus and guides T cells and B cells to secondary lymphoid organs by binding to CCR7. MIP-3 beta/CCL19 Protein, Human (HEK293) is the recombinant human-derived MIP-3 beta/CCL19 protein, expressed by HEK293, with tag free.
Background
MIP-3 beta/CCL19 Protein is suggested to have a multifaceted role, extending beyond inflammatory and immunological responses to encompass normal lymphocyte recirculation and homing. Its potential involvement in the trafficking of T-cells in the thymus, as well as the migration of both T-cells and B-cells to secondary lymphoid organs, underscores its importance in orchestrating cellular movements crucial for immune surveillance and responses. Acting through its binding to the chemokine receptor CCR7, MIP-3 beta/CCL19 demonstrates potent chemotactic activity specifically for T-cells and B-cells, excluding granulocytes and monocytes from its recruitment. Furthermore, it binds to the atypical chemokine receptor ACKR4, facilitating the recruitment of beta-arrestin (ARRB1/2) to ACKR4. Notably, MIP-3 beta/CCL19 interacts with TNFAIP6 via its Link domain, adding another layer to its complex network of molecular associations. The diverse functions of MIP-3 beta/CCL19 highlight its pivotal role in immune cell dynamics and underscore the need for comprehensive exploration into its regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q99731 (G22-S98)
-
Gene ID6363
-
Molecular Construction
-
N-term
-
CCL19 (G22-S98)
Accession # Q99731 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL19; Small-Inducible Cytokine A19; Prev. SCYA19; CC Chemokine Ligand 19; ELC; C-C Motif Chemokine 19; CK Beta-11; EBI1-Ligand Chemokine; Exodus-3; MIP-3-Beta; MIP-3b; MIP3B; CKb11; Macrophage Inflammatory Protein 3 Beta; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 19; Beta-Chemokine Exodus-3; Epstein-Barr Virus-Induced Molecule 1 Ligand Chemokine; EBI1 Ligand Chemokine; Macrophage Inflammatory Protein 3-Beta; C-C Motif Chemokine; Chemokine (C-C Motif) Ligand 19; C-C Motif Chemokine Ligand 19; Beta Chemokine Exodus-3
-
AA Sequence
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
-
Predicted Molecular Mass
8.8 kDa
-
Molecular Weight
Approximately 11-12 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
