MMP-19 Protein, Human (solution)

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human (solution) is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

MMP-19 (Matrix Metalloproteinase-19) is an endopeptidase with a crucial role in degrading various components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (COMP), particularly during development, haemostasis, and pathological conditions such as arthritic diseases. Additionally, MMP-19 may contribute to neovascularization or angiogenesis, suggesting its involvement in processes associated with new blood vessel formation. The enzyme exhibits a broad substrate specificity, hydrolyzing key extracellular matrix proteins, such as collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin. MMP-19's ability to cleave diverse substrates underscores its significance in tissue remodeling and repair, as well as its potential implication in pathological conditions characterized by aberrant extracellular matrix turnover. (

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

Tag Free

Q99542-1 (L101-G256)

4327  [NCBI]

Partial

LGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYG

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 0.1% TFA, 30% CAN.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.