1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-19
  5. MMP-19 Protein, Human (solution)

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human (solution) is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg Get quote
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-19 proteins act as endopeptidases that degrade multiple components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (comp), during critical developmental processes, hemostasis, and pathological conditions such as arthritis. ) plays a key role. In addition to participating in matrix remodeling, MMP-19 may also contribute to neovascularization, or angiogenesis. MMP-19 Protein, Human (solution) is the recombinant human-derived MMP-19 protein, expressed by E. coli , with tag free.

Background

MMP-19 (Matrix Metalloproteinase-19) is an endopeptidase with a crucial role in degrading various components of the extracellular matrix, including aggrecan and cartilage oligomeric matrix protein (COMP), particularly during development, haemostasis, and pathological conditions such as arthritic diseases. Additionally, MMP-19 may contribute to neovascularization or angiogenesis, suggesting its involvement in processes associated with new blood vessel formation. The enzyme exhibits a broad substrate specificity, hydrolyzing key extracellular matrix proteins, such as collagen type IV, laminin, nidogen, nascin-C isoform, fibronectin, and type I gelatin. MMP-19's ability to cleave diverse substrates underscores its significance in tissue remodeling and repair, as well as its potential implication in pathological conditions characterized by aberrant extracellular matrix turnover. (

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q99542-1 (L101-G256)

Gene ID
Molecular Construction
N-term
MMP-19 (L101-G256)
Accession # Q99542-1
C-term
Protein Length

Partial

Synonyms
Matrix metalloproteinase-19; MMP-19; MMP-18; RASI
AA Sequence

LGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYG

Predicted Molecular Mass
17.6 kDa
Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 0.1% TFA, 30% CAN.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

MMP-19 Protein, Human (solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MMP-19 Protein, Human (solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-19 Protein, Human (solution)
Cat. No.:
HY-P75929
Quantity:
MCE Japan Authorized Agent: