1. Recombinant Proteins
  2. Others
  3. MOG Protein, Mouse (N-His)

MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG Protein, Mouse (N-His) is the recombinant mouse-derived MOG protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG Protein, Mouse (N-His) is the recombinant mouse-derived MOG protein, expressed by E. coli , with N-His labeled tag.

Background

MOG, a minor component of the myelin sheath, plays a potential role in the finalization and/or upkeep of the myelin sheath and contributes to cell-cell communication. Functioning as a homophilic cell adhesion molecule, MOG exhibits the capacity to mediate interactions between cells through homodimerization, highlighting its involvement in establishing cellular connections within the context of myelin-related processes.

Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

Q61885 (G29-T156)

Gene ID

17441

Protein Length

Extracellular Domain

Synonyms
Myelin-oligodendrocyte glycoprotein; Mog; MOGIG2
AA Sequence

GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

Predicted Molecular Mass
20.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

MOG Protein, Mouse (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MOG Protein, Mouse (N-His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MOG Protein, Mouse (N-His)
Cat. No.:
HY-P702768
Quantity:
MCE Japan Authorized Agent: