MOG Protein, Mouse (N-His)

MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG Protein, Mouse (N-His) is the recombinant mouse-derived MOG protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG Protein, Mouse (N-His) is the recombinant mouse-derived MOG protein, expressed by E. coli , with N-His labeled tag.

Background

MOG, a minor component of the myelin sheath, plays a potential role in the finalization and/or upkeep of the myelin sheath and contributes to cell-cell communication. Functioning as a homophilic cell adhesion molecule, MOG exhibits the capacity to mediate interactions between cells through homodimerization, highlighting its involvement in establishing cellular connections within the context of myelin-related processes.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Protein Length

    Extracellular Domain

  • Synonyms

    MOG; MOG Alpha-5; Myelin Oligodendrocyte Glycoprotein; MOG AluA; Myelin-Oligodendrocyte Glycoprotein; MOG AluB; BTNL11; MOGIG2; BTN6; NRCLP7; MOG Ig-AluB

  • AA Sequence

    GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT

  • Predicted Molecular Mass

    20.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00