MOG Protein, Mouse (N-His)
MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG Protein, Mouse (N-His) is the recombinant mouse-derived MOG protein, expressed by E. coli , with N-His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MOG Protein potentially finalizes and maintains the myelin sheath, contributing to cell-cell communication. It acts as a homophilic cell adhesion molecule, mediating cellular interactions through homodimerization, indicating its involvement in establishing connections within myelin-related processes. MOG Protein, Mouse (N-His) is the recombinant mouse-derived MOG protein, expressed by E. coli , with N-His labeled tag.
Background
MOG, a minor component of the myelin sheath, plays a potential role in the finalization and/or upkeep of the myelin sheath and contributes to cell-cell communication. Functioning as a homophilic cell adhesion molecule, MOG exhibits the capacity to mediate interactions between cells through homodimerization, highlighting its involvement in establishing cellular connections within the context of myelin-related processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q61885 (G29-T156)
-
Gene ID17441
-
Protein Length
Extracellular Domain
-
Synonyms
MOG; MOG Alpha-5; Myelin Oligodendrocyte Glycoprotein; MOG AluA; Myelin-Oligodendrocyte Glycoprotein; MOG AluB; BTNL11; MOGIG2; BTN6; NRCLP7; MOG Ig-AluB
-
AA Sequence
GQFRVIGPGYPIRALVGDEAELPCRISPGKNATGMEVGWYRSPFSRVVHLYRNGKDQDAEQAPEYRGRTELLKETISEGKVTLRIQNVRFSDEGGYTCFFRDHSYQEEAAMELKVEDPFYWVNPGVLT
-
Predicted Molecular Mass
20.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
