MPZL2 Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

The MPZL2 protein centrally promotes homogeneous cell-to-cell adhesion and mediates important interactions between cells. MPZL2 has the unique ability to promote connections between identical molecules, thus helping to promote cell cohesion and maintain structural integrity. MPZL2 Protein, Human (HEK293, hFc) is the recombinant human-derived MPZL2 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The MPZL2 protein centrally promotes homogeneous cell-to-cell adhesion and mediates important interactions between cells. MPZL2 has the unique ability to promote connections between identical molecules, thus helping to promote cell cohesion and maintain structural integrity. MPZL2 Protein, Human (HEK293, hFc) is the recombinant human-derived MPZL2 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

MPZL2 Protein plays a central role in facilitating homophilic cell-cell adhesion, mediating critical interactions between cells. Through its unique ability to promote connections between identical molecules, MPZL2 is instrumental in fostering cellular cohesion and maintaining structural integrity. The protein's involvement in homophilic adhesion underscores its specificity and significance in various biological processes where the coordination of cell interactions is paramount. As a key mediator, MPZL2 contributes to the intricate network of cellular adhesion, emphasizing its essential role in facilitating communication and cooperation between neighboring cells.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MPZL2 (V27-L154)
      Accession # O60487
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    MPZL2; Epithelial V-Like Antigen 1; Prev. EVA1; DFNB111; EVA; Myelin Protein Zero Like 2; Myelin Protein Zero-Like Protein 2

  • AA Sequence

    VEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFL

  • Predicted Molecular Mass

    41.4 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00