MPZL2 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
The MPZL2 protein centrally promotes homogeneous cell-to-cell adhesion and mediates important interactions between cells. MPZL2 has the unique ability to promote connections between identical molecules, thus helping to promote cell cohesion and maintain structural integrity. MPZL2 Protein, Human (HEK293, hFc) is the recombinant human-derived MPZL2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The MPZL2 protein centrally promotes homogeneous cell-to-cell adhesion and mediates important interactions between cells. MPZL2 has the unique ability to promote connections between identical molecules, thus helping to promote cell cohesion and maintain structural integrity. MPZL2 Protein, Human (HEK293, hFc) is the recombinant human-derived MPZL2 protein, expressed by HEK293 , with C-hFc labeled tag.
MPZL2 Protein plays a central role in facilitating homophilic cell-cell adhesion, mediating critical interactions between cells. Through its unique ability to promote connections between identical molecules, MPZL2 is instrumental in fostering cellular cohesion and maintaining structural integrity. The protein's involvement in homophilic adhesion underscores its specificity and significance in various biological processes where the coordination of cell interactions is paramount. As a key mediator, MPZL2 contributes to the intricate network of cellular adhesion, emphasizing its essential role in facilitating communication and cooperation between neighboring cells.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O60487 (V27-L154)
-
Molecular Construction
-
N-term
-
MPZL2 (V27-L154)
Accession # O60487 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
MPZL2; Epithelial V-Like Antigen 1; Prev. EVA1; DFNB111; EVA; Myelin Protein Zero Like 2; Myelin Protein Zero-Like Protein 2
-
AA Sequence
VEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFL
-
Predicted Molecular Mass
41.4 kDa
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
