MTFP1 Protein, Human (GST)
MTFP1 Protein, Human (GST) is the recombinant human-derived MTFP1, expressed by E. coli , with N-GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MTFP1 Protein, Human (GST) is the recombinant human-derived MTFP1, expressed by E. coli , with N-GST labeled tag. ,
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q9UDX5-1 (M1-S166)
-
Gene ID51537
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MTFP1; HSPC242; Mitochondrial Fission Process 1; Mitochondrial Fission Protein MTP18; MTP18; Mitochondrial Protein 18 KDa; Mitochondrial Fission Process Protein 1; Alternative Protein MTFP1; Mitochondrial 18 KDa Protein
-
AA Sequence
MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
-
Predicted Molecular Mass
45 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)