Mucin-1/MUC1 Protein, Human (HEK293)
Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Mucin-1/MUC1 protein and its α subunit have dual functions of adhesion and anti-adhesion proteins, forming a protective layer on epithelial cells. At the same time, the β subunit and its C-terminal domain participate in cell signaling through phosphorylation and protein-protein interactions. Mucin-1/MUC1 Protein, Human (HEK293) is the recombinant human-derived Mucin-1/MUC1 protein, expressed by HEK293 , with tag free.
Background
The Mucin-1/MUC1 protein exhibits diverse functional roles: the alpha subunit possesses cell adhesive properties and functions as both an adhesion and an anti-adhesion protein, potentially forming a protective layer on epithelial cells against bacterial and enzyme attacks. Simultaneously, the beta subunit, with its C-terminal domain, engages in cell signaling through phosphorylations and protein-protein interactions. Mucin-1/MUC1 modulates signaling in ERK, SRC, and NF-kappa-B pathways, influencing the Ras/MAPK pathway in activated T-cells. Additionally, it plays a role in promoting tumor progression, regulating TP53-mediated transcription, and determining cell fate in the genotoxic stress response. Notably, in conjunction with KLF4, Mucin-1/MUC1 binds to the PE21 promoter element of TP53, thereby repressing TP53 activity and contributing to the intricate network of cellular functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P15941-11 (S33-G167)
-
Molecular Construction
-
N-term
-
Mucin-1 (S33-G167)
Accession # P15941-11 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MUC1; Mucin Short Variant E1; Prev. PUM; MUC1 Isoform SV7-LSP; Prev. MCKD1; MUC1 Isoform J18; KL-6; MUC1 Isoform J16; PEM; MUC1 Isoform J15; EMA; MUC1 Isoform J24; ADMCKD1; MUC1 Isoform T12; Mucin-1; MUC1 Isoform T13; ADMCKD; MUC1 Isoform M11; Ca15-3; MUC
-
AA Sequence
SGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPG
-
Predicted Molecular Mass
15.4 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
