Mucin-2/MUC2 Protein, Human (His)
Based on 1 Customer Validation
Mucin-2/MUC2 Protein, Human (His) is the recombinant human-derived Mucin-2/MUC2, expressed by E. coli , with N-6*His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Mucin-2/MUC2 Protein, Human (His) is the recombinant human-derived Mucin-2/MUC2, expressed by E. coli , with N-6*His labeled tag. ,
Background
MUC2 is a mucin that coats the epithelia of the intestines and other mucus membrane-containing organs, providing a protective and lubricating barrier against particles and infectious agents at mucosal surfaces. As the major constituent of colon mucus, it forms large polymeric networks secreted by goblet cells, covering the intestinal surfaces. These networks create hydrogels that shield the underlying epithelium from pathogens and hazardous materials while enabling nutrient absorption and gas exchange. MUC2 also acts as a divalent copper chaperone, protecting intestinal cells from copper toxicity and facilitating nutritional copper uptake. It binds both Cu2+ and Cu(1+) at adjacent sites, with Cu2+ reduced to Cu(1+) by vitamin C or dietary antioxidants, allowing its release for cellular uptake. Additionally, MUC2 gels store antimicrobial molecules for innate immunity, support the microbiome, lubricate tissues, and aid in waste removal. By similarity, goblet cells produce two forms of MUC2: a 'thick' mucus in the proximal colon that encases microbiota to form fecal pellets, and a 'thin' mucus in the distal colon that adheres to and lubricates the 'thick' mucus as it moves through the descending colon.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q02817 (V36-L240)
-
Gene ID4583
-
Protein Length
Partial
-
Synonyms
MUC2; SMUC; Mucin 2, Oligomeric Mucus/Gel-Forming; Intestinal Mucin 2.1; MUC-2; Intestinal Mucin-2; MLP; Intestinal Mucin 2; Mucin 2, Intestinal/Tracheal; Intestinal Mucin; Mucin-Like Protein; Mucin 2; Mucin-2
-
AA Sequence
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
-
Predicted Molecular Mass
28.8 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)