MUCL1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MUCL1 protein has the potential to serve as a diagnostic marker for metastatic breast cancer, providing utility in identifying and characterizing this disease stage. It can serve as a molecular marker to aid diagnosis and evaluation and have an impact on treatment planning and prognosis. MUCL1 Protein, Human (HEK293, His) is the recombinant human-derived MUCL1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The MUCL1 protein is suggested to potentially play a role as a diagnostic marker for metastatic breast cancer, indicating its potential utility in identifying and characterizing this particular stage of the disease. The implication is that MUCL1 could serve as a molecular indicator, aiding in the diagnosis and assessment of metastatic breast cancer, which may have implications for treatment planning and prognosis. The precise mechanisms and specificity of MUCL1 in the context of breast cancer diagnosis remain areas of interest, highlighting its potential significance as a biomarker in clinical settings.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q96DR8 (N21-P90)
-
Molecular Construction
-
N-term
-
MUCL1 (N21-P90)
Accession # Q96DR8 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MUCL1; Small Breast Epithelial Mucin; Mucin Like 1; Mucin-Like Protein 1; SBEM; Protein BS106
-
AA Sequence
NPTTAAPADTYPATGPADDEAPDAETTAAATTATTAAPTTATTAASTTARKDIPVLPKWVGDLPNGRVCP
-
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
