Murinoglobulin-1/Mug1 Protein, Mouse (His)
Based on 1 Customer Validation
Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.
Background
Murinoglobulin-1 (Mug1) operates as a proteinase inhibitor through a specific proteolytic activation mechanism in the bait region. This activation triggers a reaction at the cysteinyl-glutamyl internal thiol ester site, leading to a conformational change that effectively traps or covalently binds the proteinase to the inhibitor. In tetrameric forms of this proteinase inhibitor, steric hindrance alone provides robust inhibition. However, in monomeric configurations, an additional covalent linkage is essential between the activated glutamyl residue and a terminal amino group of a lysine or another nucleophilic group on the proteinase for inhibition to be fully effective. This intricate process highlights Mug1's ability to modulate proteinase activity through a combination of structural and chemical interactions.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P28665 (T700-E910)
-
Gene ID17836 [NCBI]
-
Molecular Construction
-
N-term
-
6*His
-
Mug1 (T700-E910)
Accession # P28665 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Murinoglobulin-1; MuG1; Mug1; Mug-1
-
AA Sequence
TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE
-
Predicted Molecular Mass
27 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCI, 1 mM EDTA, 6%
trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
